HELLOQUEENSTOWN.COM
Shared Attributes
Domain
hellosouthsioux.com hellosouthsioux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
hellonatchez.com hellonatchez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
AOL AOL-6748 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloportsaid.com helloportsaid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
helloquebec.com helloquebec.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
hellofez.com hellofez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
UA UA-121239807 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
NEX NEX-3391 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
hellomanagua.com hellomanagua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellomountainview.com hellomountainview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
helloshoreview.com helloshoreview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellombuji-mayi.com hellombuji-mayi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellostockholm.com hellostockholm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellotolyatti.com hellotolyatti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellococoa.com hellococoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 May 2016 2 years, 209 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
hellojamestown.com hellojamestown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
hellolucern.com hellolucern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Mar 2020 1 year, 227 days
GTM GTM-UA-118129358-1 May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellomaseru.com hellomaseru.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 148 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 26 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
DM DM-101492 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellonorfolk.com hellonorfolk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-AW-804755169 Nov 2018 Aug 2019 276 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloflagstaff.com helloflagstaff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 14 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
hellohalifax.com hellohalifax.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellomiddletown.com hellomiddletown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762769 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
hellonagoya.com hellonagoya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
DM DM-101492 May 2019 May 2019 One Off
SVRN SVRN-261774 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
hellonorwalk.com hellonorwalk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellosuffolk.com hellosuffolk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellozibo.com hellozibo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
hellojohnstown.com hellojohnstown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellomadrid.com hellomadrid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
helloyoungstown.com helloyoungstown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
FWHL FWHL-762769 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF May 2019 Aug 2019 98 days
MEDI MEDI-8CU7QPX3O May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellofreetown.com hellofreetown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
UA UA-121239807 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
MEDI MEDI-8CU7QPX3O May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
hellogilberttown.com hellogilberttown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
helloluzern.com helloluzern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Mar 2020 1 year, 227 days
GTM GTM-UA-118129358-1 Jun 2019 Dec 2019 175 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellomoundsview.com hellomoundsview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
hellomukilteo.com hellomukilteo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
hellonewyorkcity.com hellonewyorkcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6748 Jun 2019 Oct 2019 130 days
SVRN SVRN-261774 Jun 2019 Oct 2019 130 days
SVRN SVRN-265277 Jun 2019 Oct 2019 130 days
LIJI LIJI-265277 Jun 2019 Oct 2019 130 days
ORC ORC-963 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
AOL AOL-6614 Jul 2019 Oct 2019 82 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 69 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
DM DM-101492 Sep 2019 Oct 2019 26 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellonovosibirsk.com hellonovosibirsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
helloradcliff.com helloradcliff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
helloraytown.com helloraytown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762769 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF May 2019 Aug 2019 98 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellosamoa.com hellosamoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellobethlehem.com hellobethlehem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
ORC ORC-402 May 2019 Aug 2019 98 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
hellodoylestown.com hellodoylestown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762769 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
hellomacomb.com hellomacomb.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 254 days
GTM GTM-AW-804755169 Nov 2018 Aug 2019 276 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
helloperu.com helloperu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 148 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 26 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
helloplainview.com helloplainview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellosaintjohn.com hellosaintjohn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Nov 2018 Aug 2019 276 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
hellosalem.com hellosalem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellosanmateo.com hellosanmateo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Aug 2019 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
hellotahlequah.com hellotahlequah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Mar 2014 2 years, 14 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellowoodburn.com hellowoodburn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
TREM TREM-J54V6-5C8FF May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
helloyazoo.com helloyazoo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
hellobengaluru.com hellobengaluru.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellogenoa.com hellogenoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellomaranatown.com hellomaranatown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
UA UA-121239807 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762769 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
MEDI MEDI-8CU7QPX3O May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
TREM TREM-J54V6-5C8FF May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellomenasha.com hellomenasha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloomaha.com helloomaha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
ORC ORC-402 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloorem.com helloorem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
helloqingdao.com helloqingdao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellosandusky.com hellosandusky.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-AW-804755169 Nov 2018 Aug 2019 276 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
hellothibodaux.com hellothibodaux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
hellozaporizhzhya.com hellozaporizhzhya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 May 2019 Jun 2019 48 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
DM DM-101492 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Jun 2019 Jun 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
helloeastchicago.com helloeastchicago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-AW-804755169 Nov 2018 Aug 2019 276 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
UA UA-121239807 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
hellolittleelm.com hellolittleelm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
hellonewulm.com hellonewulm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
hellonorristown.com hellonorristown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-AW-804755169 Sep 2018 May 2019 232 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762769 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
hellopoplarbluff.com hellopoplarbluff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
hellosavannah.com hellosavannah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
helloantigua.com helloantigua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
helloaruba.com helloaruba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloelk.com helloelk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Mar 2014 2 years, 14 days
GTM GTM-AW-804755169 Nov 2018 Aug 2019 276 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
AOL AOL-6748 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellograndview.com hellograndview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellotamarac.com hellotamarac.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
hellotaraz.com hellotaraz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
helloallentown.com helloallentown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Sep 2018 May 2019 232 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellograz.com hellograz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
helloizhevsk.com helloizhevsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
helloottawa.com helloottawa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
hellosantafa.com hellosantafa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Oct 2019 1 year, 64 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
LIJI LIJI-265277 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-963 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
AOL AOL-6748 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
hellotahiti.com hellotahiti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
helloallouez.com helloallouez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
LIJI LIJI-265277 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellobardstown.com hellobardstown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
MEDI MEDI-8CU7QPX3O May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
GTM GTM-AW-804755169 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
hellomalabo.com hellomalabo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
hellonanaimo.com hellonanaimo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
helloneenah.com helloneenah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
helloparamaribo.com helloparamaribo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
GTM GTM-UA-118129358-1 May 2019 Nov 2020 1 year, 182 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
LIJI LIJI-265277 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
helloschertz.com helloschertz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellowindhoek.com hellowindhoek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 May 2019 Jan 2021 1 year, 255 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellogaziantep.com hellogaziantep.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
hellohaiti.com hellohaiti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellolodz.com hellolodz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
ORC ORC-963 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 24 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
hellominneapolis.com hellominneapolis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-261774 Jun 2019 Oct 2019 130 days
LIJI LIJI-265277 Jun 2019 Oct 2019 130 days
DM DM-101492 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
AOL AOL-6748 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
AOL AOL-6614 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
ORC ORC-963 Jul 2019 Oct 2019 81 days
CA CA-PUB-8425488243879801 May 2019 Jul 2019 78 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
AOL AOL-11647 Sep 2019 Oct 2019 26 days
SVRN SVRN-265277 Sep 2019 Oct 2019 26 days
DM DM-100974 Jul 2019 Aug 2019 20 days
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
hellooakcreek.com hellooakcreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2018 Jan 2021 2 years, 68 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-AW-804755169 Nov 2018 Aug 2019 276 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellooconomowoc.com hellooconomowoc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellopiqua.com hellopiqua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
hellosaintpaul.com hellosaintpaul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-8425488243879801 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
hellosanaa.com hellosanaa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
MEDI MEDI-8CU7QPX3O Jun 2019 Aug 2019 50 days
ORC ORC-402 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
AOL AOL-6614 Jun 2019 Jun 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
helloscottsbluff.com helloscottsbluff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellosioux.com hellosioux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellotokyo.com hellotokyo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
AOL AOL-6748 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellocuracao.com hellocuracao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
hellodavao.com hellodavao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
hellokalamazoo.com hellokalamazoo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
hellolodi.com hellolodi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Jun 2019 Jun 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
hellomoroni.com hellomoroni.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellonicaragua.com hellonicaragua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
hellopeterborough.com hellopeterborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloqueencreek.com helloqueencreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2018 Jan 2021 2 years, 68 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
helloutah.com helloutah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellowalnutcreek.com hellowalnutcreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 May 2019 Jan 2021 1 year, 255 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloadisabeba.com helloadisabeba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
UA UA-350746 Feb 2012 Feb 2012 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellocorpuschristi.com hellocorpuschristi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
helloglenview.com helloglenview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 May 2016 2 years, 209 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellojacksonville.com hellojacksonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Sep 2018 Jul 2019 309 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
TREM TREM-J54V6-5C8FF Jul 2019 Oct 2019 82 days
ORC ORC-963 Jul 2019 Oct 2019 82 days
SVRN SVRN-265277 Jul 2019 Oct 2019 82 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
CONN CONN-102738 Jul 2019 Oct 2019 82 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 82 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-6614 Sep 2019 Oct 2019 26 days
AOL AOL-6748 Sep 2019 Oct 2019 26 days
SVRN SVRN-261774 Sep 2019 Oct 2019 26 days
LIJI LIJI-265277 Sep 2019 Oct 2019 26 days
DM DM-101492 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 23 days
DM DM-100974 Jul 2019 Aug 2019 21 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Sep 2019 Sep 2019 One Off
hellotaunggyi.com hellotaunggyi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
MEDI MEDI-8CU7QPX3O May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
hellococonutcreek.com hellococonutcreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-350746 Oct 2013 Oct 2013 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellohuntsville.com hellohuntsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
LIJI LIJI-265277 Jun 2019 Oct 2019 130 days
SVRN SVRN-261774 Jun 2019 Oct 2019 130 days
AOL AOL-6614 Jun 2019 Oct 2019 130 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
ORC ORC-963 Jul 2019 Oct 2019 81 days
SVRN SVRN-265277 Jul 2019 Oct 2019 81 days
AOL AOL-6748 Jul 2019 Oct 2019 81 days
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellomalibu.com hellomalibu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
hellothimphu.com hellothimphu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellowinston-salem.com hellowinston-salem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
helloalexandriaegypt.com helloalexandriaegypt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Mar 2020 Jan 2021 298 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
ORC ORC-402 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellobiloxi.com hellobiloxi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
helloblackfoot.com helloblackfoot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
DM DM-101492 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
hellofaribault.com hellofaribault.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
AOL AOL-6614 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloidaho.com helloidaho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Jun 2019 Jun 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
hellopinebluff.com hellopinebluff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellosantaclara.com hellosantaclara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Sep 2019 133 days
SVRN SVRN-265277 Jun 2019 Oct 2019 130 days
ORC ORC-963 Jun 2019 Oct 2019 130 days
AOL AOL-6614 Jun 2019 Oct 2019 130 days
AOL AOL-6748 Jun 2019 Oct 2019 130 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 130 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
DM DM-101492 Jul 2019 Oct 2019 82 days
SVRN SVRN-261774 Jul 2019 Oct 2019 82 days
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
DM DM-100974 Jun 2019 Aug 2019 69 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-265277 Sep 2019 Oct 2019 26 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellobattlecreek.com hellobattlecreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
helloguelph.com helloguelph.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
AOL AOL-6614 May 2019 May 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
hellomanitowoc.com hellomanitowoc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Jun 2014 2 years, 105 days
UA UA-121239807 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
hellosouthlaketahoe.com hellosouthlaketahoe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-AW-804755169 Nov 2018 Aug 2019 276 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
hellotaipei.com hellotaipei.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
DM DM-101492 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
AOL AOL-6614 May 2019 Jun 2019 48 days
FWHL FWHL-762769 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 14 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellowinnipeg.com hellowinnipeg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
AOL AOL-6614 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
FWHL FWHL-762737 May 2019 May 2019 One Off
SVRN SVRN-261774 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
hellocuba.com hellocuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF May 2019 Aug 2019 98 days
MEDI MEDI-8CU7QPX3O May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
AOL AOL-6614 Jun 2019 Aug 2019 50 days
UA UA-121239807 May 2019 Jun 2019 48 days
SVRN SVRN-265277 May 2019 Jun 2019 48 days
LIJI LIJI-265277 May 2019 Jun 2019 48 days
ORC ORC-402 May 2019 Jun 2019 48 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 May 2019 May 2019 One Off
DM DM-100974 May 2019 May 2019 One Off
NEX NEX-3391 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellodavenport.com hellodavenport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Oct 2018 Aug 2019 300 days
UA UA-121239807 Jun 2019 Oct 2019 130 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 130 days
DM DM-101492 Jun 2019 Oct 2019 130 days
SVRN SVRN-261774 Jun 2019 Oct 2019 130 days
ORC ORC-963 Jun 2019 Oct 2019 130 days
AOL AOL-6748 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
TREM TREM-J54V6-5C8FF Jun 2019 Sep 2019 104 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
DM DM-100974 Jun 2019 Aug 2019 69 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jul 2019 Sep 2019 55 days
FWHL FWHL-762769 Jun 2019 Jul 2019 49 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
SVRN SVRN-265277 Sep 2019 Oct 2019 26 days
LIJI LIJI-265277 Sep 2019 Oct 2019 26 days
IEX IEX-189205 Sep 2019 Oct 2019 26 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellofortaleza.com hellofortaleza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
helloshanghai.com helloshanghai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
UA UA-121239807 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
helloaddisababa.com helloaddisababa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
AOL AOL-6614 May 2019 Jun 2019 48 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellobelleview.com hellobelleview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
hellochicago.com hellochicago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Nov 2018 Aug 2019 276 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellomccomb.com hellomccomb.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
SVRN SVRN-265277 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellomississippi.com hellomississippi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloriorancho.com helloriorancho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 May 2019 Jan 2021 1 year, 255 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
LIJI LIJI-265277 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
AOL AOL-6614 May 2019 Jun 2019 48 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellosaratov.com hellosaratov.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
DM DM-100974 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
ORC ORC-963 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
helloalsip.com helloalsip.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellobuckeyetown.com hellobuckeyetown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF May 2019 Aug 2019 98 days
MEDI MEDI-8CU7QPX3O May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
UA UA-121239807 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellocolumbia.com hellocolumbia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 130 days
SVRN SVRN-261774 Jun 2019 Oct 2019 130 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 130 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
UA UA-121239807 Jun 2019 Sep 2019 104 days
GTM GTM-UA-121239807-2 Jul 2019 Oct 2019 81 days
SVRN SVRN-265277 Jul 2019 Oct 2019 81 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-6614 Sep 2019 Oct 2019 26 days
ORC ORC-963 Sep 2019 Oct 2019 26 days
LIJI LIJI-265277 Sep 2019 Oct 2019 26 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
DM DM-100974 Jul 2019 Aug 2019 20 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellocolumbus.com hellocolumbus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 130 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 130 days
SVRN SVRN-265277 Jun 2019 Oct 2019 130 days
LIJI LIJI-265277 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
AOL AOL-6614 Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
ORC ORC-963 Jul 2019 Oct 2019 81 days
DM DM-101492 Jul 2019 Oct 2019 81 days
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
TREM TREM-J54V6-5C8FF Jul 2019 Oct 2019 81 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
AOL AOL-6748 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 26 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
hellolaketahoe.com hellolaketahoe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
DM DM-100974 May 2019 May 2019 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
hellolincoln.com hellolincoln.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
hellonewburgh.com hellonewburgh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellonewlenox.com hellonewlenox.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
helloraleigh.com helloraleigh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
hellosaintpetersburg.com hellosaintpetersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 130 days
SVRN SVRN-261774 Jun 2019 Oct 2019 130 days
AOL AOL-6748 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
LIJI LIJI-265277 Jul 2019 Oct 2019 82 days
ORC ORC-963 Jul 2019 Oct 2019 82 days
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
TREM TREM-J54V6-5C8FF Jul 2019 Oct 2019 82 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jul 2019 Sep 2019 56 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
AOL AOL-11647 Aug 2019 Sep 2019 35 days
AOL AOL-6614 Sep 2019 Oct 2019 26 days
DM DM-100974 Jul 2019 Aug 2019 21 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellosanluisobispo.com hellosanluisobispo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellosiemreap.com hellosiemreap.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
DM DM-100974 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
helloantwerp.com helloantwerp.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
NEX NEX-3391 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloarlingtontx.com helloarlingtontx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Mar 2020 1 year, 227 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
hellobaytown.com hellobaytown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
hellochicopee.com hellochicopee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
LIJI LIJI-265277 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
hellocouncilbluffs.com hellocouncilbluffs.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
FWHL FWHL-762769 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellodekalb.com hellodekalb.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
AOL AOL-6748 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellolilongwe.com hellolilongwe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
TREM TREM-J54V6-5C8FF Jun 2019 Aug 2019 50 days
DM DM-101492 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
AOL AOL-6748 May 2019 May 2019 One Off
ORC ORC-963 May 2019 May 2019 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
hellomogadishu.com hellomogadishu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellonixa.com hellonixa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Aug 2019 98 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
MEDI MEDI-8CU7QPX3O May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
DM DM-101492 May 2019 Jun 2019 48 days
ORC ORC-402 May 2019 Jun 2019 48 days
AOL AOL-6748 May 2019 Jun 2019 48 days
FWHL FWHL-762769 May 2019 Jun 2019 48 days
TREM TREM-J54V6-5C8FF May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloprovo.com helloprovo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
hellowaterloo.com hellowaterloo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Feb 2014 1 year, 352 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
FWHL FWHL-762737 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
helloajax.com helloajax.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
SVRN SVRN-261774 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
helloconnecticut.com helloconnecticut.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellolenexa.com hellolenexa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-121239807-2 May 2019 Jun 2019 48 days
DM DM-100974 May 2019 Jun 2019 48 days
LIJI LIJI-265277 May 2019 Jun 2019 48 days
ORC ORC-402 May 2019 Jun 2019 48 days
AOL AOL-6614 May 2019 Jun 2019 48 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloplumborough.com helloplumborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloanaheim.com helloanaheim.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-121239807 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
hellohochiminh.com hellohochiminh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
helloirmo.com helloirmo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
AOL AOL-6748 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
helloistanbul.com helloistanbul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
ORC ORC-402 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
hellomerced.com hellomerced.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 130 days
LIJI LIJI-265277 Jun 2019 Oct 2019 130 days
AOL AOL-6748 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
GTM GTM-UA-121239807-2 Jul 2019 Oct 2019 82 days
DM DM-101492 Jul 2019 Oct 2019 82 days
TREM TREM-J54V6-5C8FF Jul 2019 Oct 2019 82 days
CA CA-PUB-8425488243879801 May 2019 Jul 2019 77 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Jul 2019 Sep 2019 56 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
ORC ORC-963 Sep 2019 Oct 2019 26 days
IEX IEX-189205 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellosacramento.com hellosacramento.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 130 days
LIJI LIJI-265277 Jun 2019 Oct 2019 130 days
ORC ORC-963 Jun 2019 Oct 2019 130 days
AOL AOL-6614 Jun 2019 Oct 2019 130 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 130 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
SVRN SVRN-261774 Jun 2019 Sep 2019 104 days
GTM GTM-UA-121239807-2 Jul 2019 Oct 2019 81 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 26 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Jul 2019 Jul 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Sep 2019 Sep 2019 One Off
hellostjohn.com hellostjohn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
FWHL FWHL-762769 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
hellofonddulac.com hellofonddulac.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
TREM TREM-J54V6-5C8FF Jun 2019 Jun 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
hellojaffa.com hellojaffa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-963 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellopasadena.com hellopasadena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6748 Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
SVRN SVRN-265277 Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 103 days
UA UA-121239807 Jul 2019 Oct 2019 81 days
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
DM DM-101492 Jul 2019 Oct 2019 81 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 68 days
DM DM-100974 Jun 2019 Aug 2019 68 days
ORC ORC-402 Jun 2019 Aug 2019 68 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Jul 2019 Sep 2019 55 days
LIJI LIJI-265277 Jul 2019 Sep 2019 55 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
ORC ORC-963 Sep 2019 Oct 2019 26 days
IEX IEX-189205 Sep 2019 Oct 2019 26 days
TREM TREM-J54V6-5C8FF Sep 2019 Oct 2019 26 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellosantacruz.com hellosantacruz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
helloabuja.com helloabuja.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762769 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
AOL AOL-6614 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
helloantananarivo.com helloantananarivo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
hellobemidji.com hellobemidji.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
hellochattanooga.com hellochattanooga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
hellodc.com hellodc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellohialeah.com hellohialeah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
hellohonolulu.com hellohonolulu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
hellokentucky.com hellokentucky.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
helloberwyn.com helloberwyn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellogaza.com hellogaza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
hellolibya.com hellolibya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
SVRN SVRN-261774 May 2019 May 2019 One Off
TREM TREM-J54V6-5C8FF May 2019 May 2019 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
ORC ORC-402 Jun 2019 Jun 2019 One Off
hellospokane.com hellospokane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
DM DM-101492 Jul 2019 Oct 2019 81 days
SVRN SVRN-265277 Jul 2019 Oct 2019 81 days
TREM TREM-J54V6-5C8FF Jul 2019 Oct 2019 81 days
CONN CONN-102738 Jul 2019 Oct 2019 81 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 81 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jul 2019 Sep 2019 55 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-11647 Sep 2019 Oct 2019 26 days
FWHL FWHL-970193 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 26 days
SVRN SVRN-261774 Sep 2019 Oct 2019 26 days
ORC ORC-963 Sep 2019 Oct 2019 26 days
GTM GTM-AW-804755169 Jul 2019 Aug 2019 20 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellodearborn.com hellodearborn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 111 days
DM DM-100974 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
AOL AOL-6614 May 2019 May 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
hellofuzhou.com hellofuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellogurnee.com hellogurnee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
MEDI MEDI-8CU7QPX3O Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
hellonewdelhi.com hellonewdelhi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
hellounionnj.com hellounionnj.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
helloalisoviejo.com helloalisoviejo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellonorthmiami.com hellonorthmiami.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
hellooahu.com hellooahu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 129 days
SVRN SVRN-265277 Jun 2019 Oct 2019 129 days
LIJI LIJI-265277 Jun 2019 Oct 2019 129 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 129 days
AOL AOL-6614 Jun 2019 Oct 2019 129 days
DM DM-101492 Jun 2019 Oct 2019 129 days
ORC ORC-963 Jun 2019 Oct 2019 129 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
FWHL FWHL-970193 Aug 2019 Sep 2019 35 days
GTM GTM-UA-121239807-2 Sep 2019 Oct 2019 26 days
AOL AOL-11647 Sep 2019 Oct 2019 26 days
DM DM-100974 Jul 2019 Aug 2019 20 days
NEX NEX-3391 Jul 2019 Aug 2019 20 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
SVRN SVRN-261774 Jul 2019 Jul 2019 One Off
hellosaintlouis.com hellosaintlouis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 129 days
LIJI LIJI-265277 Jun 2019 Oct 2019 129 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
DM DM-101492 Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
UA UA-121239807 Jun 2019 Oct 2019 129 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
ORC ORC-402 Jun 2019 Aug 2019 68 days
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
DM DM-100974 Jul 2019 Aug 2019 20 days
NEX NEX-3391 Jul 2019 Aug 2019 20 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
hellovaduz.com hellovaduz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Dec 2019 Jan 2021 1 year, 32 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
hellocharleston.com hellocharleston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
TREM TREM-J54V6-5C8FF Jul 2019 Oct 2019 81 days
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
CONN CONN-102738 Jul 2019 Oct 2019 81 days
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 81 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
AOL AOL-6748 Sep 2019 Oct 2019 26 days
FWHL FWHL-970193 Sep 2019 Oct 2019 26 days
SVRN SVRN-265277 Sep 2019 Oct 2019 26 days
LIJI LIJI-265277 Sep 2019 Oct 2019 26 days
ORC ORC-963 Sep 2019 Oct 2019 26 days
DM DM-100974 Jul 2019 Aug 2019 20 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
GTM GTM-AW-804755169 Jul 2019 Jul 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellocrestview.com hellocrestview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
hellofortbragg.com hellofortbragg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
TREM TREM-J54V6-5C8FF Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
hellogalt.com hellogalt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
helloouagadougou.com helloouagadougou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Dec 2019 Jan 2021 1 year, 32 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellooshawa.com hellooshawa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
hellophiladelphia.com hellophiladelphia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 Jun 2019 Oct 2019 129 days
DM DM-101492 Jun 2019 Oct 2019 129 days
SVRN SVRN-265277 Jun 2019 Oct 2019 129 days
LIJI LIJI-265277 Jun 2019 Oct 2019 129 days
ORC ORC-963 Jun 2019 Oct 2019 129 days
AOL AOL-6614 Jun 2019 Oct 2019 129 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
UA UA-121239807 May 2019 Jul 2019 78 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
IEX IEX-189205 Aug 2019 Sep 2019 35 days
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 25 days
DM DM-100974 Jul 2019 Aug 2019 20 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellochickasha.com hellochickasha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
NEX NEX-3391 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
hellopittsburgh.com hellopittsburgh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
LIJI LIJI-265277 Jun 2019 Oct 2019 129 days
ORC ORC-963 Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
CA CA-PUB-8425488243879801 Jun 2019 Sep 2019 103 days
DM DM-101492 Jun 2019 Sep 2019 103 days
MEDI MEDI-8CU7QPX3O Jun 2019 Sep 2019 103 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Jun 2019 Jul 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 25 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 22 days
DM DM-100974 Jul 2019 Aug 2019 20 days
NEX NEX-3391 Jul 2019 Aug 2019 20 days
SVRN SVRN-265277 Jun 2019 Jun 2019 One Off
TREM TREM-J54V6-5C8FF Jun 2019 Jun 2019 One Off
hellosuisun.com hellosuisun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
DM DM-101492 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellomaiduguri.com hellomaiduguri.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
ORC ORC-963 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
helloroyaloak.com helloroyaloak.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellowashingtondc.com hellowashingtondc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Oct 2018 Aug 2019 300 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 130 days
LIJI LIJI-265277 Jun 2019 Oct 2019 130 days
ORC ORC-963 Jun 2019 Oct 2019 130 days
AOL AOL-6748 Jun 2019 Oct 2019 130 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 130 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
DM DM-100974 Jun 2019 Aug 2019 69 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
CA CA-PUB-8425488243879801 Sep 2019 Oct 2019 26 days
DM DM-101492 Sep 2019 Oct 2019 26 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
helloenumclaw.com helloenumclaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Jun 2019 Jun 2019 One Off
hellosantabarbara.com hellosantabarbara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 130 days
DM DM-101492 Jun 2019 Oct 2019 130 days
SVRN SVRN-261774 Jun 2019 Oct 2019 130 days
AOL AOL-6614 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
UA UA-121239807 Jul 2019 Oct 2019 81 days
ORC ORC-963 Jul 2019 Oct 2019 81 days
AOL AOL-6748 Jul 2019 Oct 2019 81 days
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Jul 2019 49 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
DM DM-100974 Jul 2019 Aug 2019 20 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellosunnyvale.com hellosunnyvale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 Jun 2019 Oct 2019 129 days
SVRN SVRN-261774 Jun 2019 Oct 2019 129 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 129 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
FWHL FWHL-762769 Jun 2019 Sep 2019 103 days
ORC ORC-402 Jun 2019 Aug 2019 68 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jul 2019 Sep 2019 55 days
GTM GTM-AW-804755169 Apr 2019 Jun 2019 52 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
SVRN SVRN-265277 Sep 2019 Oct 2019 26 days
LIJI LIJI-265277 Sep 2019 Oct 2019 26 days
ORC ORC-963 Sep 2019 Oct 2019 26 days
DM DM-100974 Jul 2019 Aug 2019 20 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Jun 2019 Jun 2019 One Off
helloaleppo.com helloaleppo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellohawaii.com hellohawaii.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellotelaviv.com hellotelaviv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellolouisville.com hellolouisville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 Jun 2019 Oct 2019 129 days
CA CA-PUB-8425488243879801 Jun 2019 Oct 2019 129 days
AOL AOL-6614 Jun 2019 Oct 2019 129 days
FWHL FWHL-762769 Jun 2019 Oct 2019 129 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
DM DM-101492 Jun 2019 Oct 2019 129 days
SVRN SVRN-265277 Jun 2019 Oct 2019 129 days
LIJI LIJI-265277 Jun 2019 Oct 2019 129 days
ORC ORC-963 Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
NEX NEX-3391 Jun 2019 Aug 2019 68 days
DM DM-100974 Jun 2019 Aug 2019 68 days
ORC ORC-402 Jun 2019 Aug 2019 68 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 25 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobellevue.com hellobellevue.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
hellobronx.com hellobronx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-AW-804755169 Sep 2018 Jun 2019 280 days
UA UA-121239807 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
hellocoalinga.com hellocoalinga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-350746 Oct 2013 Oct 2013 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
hellomilwaukee.com hellomilwaukee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 Jul 2019 Oct 2019 81 days
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
CA CA-PUB-8425488243879801 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
CONN CONN-102738 Jul 2019 Oct 2019 81 days
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 81 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-6614 Sep 2019 Oct 2019 26 days
FWHL FWHL-970193 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 26 days
DM DM-101492 Sep 2019 Oct 2019 26 days
ORC ORC-963 Sep 2019 Oct 2019 26 days
TREM TREM-J54V6-5C8FF Sep 2019 Oct 2019 26 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
DM DM-100974 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 15 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellosoutheuclid.com hellosoutheuclid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
TEAD TEAD-16544 Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
TELA TELA-457 Oct 2019 Oct 2019 One Off
AVVID AVVID-7802 Oct 2019 Oct 2019 One Off
CONN CONN-102738 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Oct 2019 One Off
YUME YUME-4016333178 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
GUMG GUMG-13810 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
hellotabriz.com hellotabriz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
hellomcdonough.com hellomcdonough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellomillbrae.com hellomillbrae.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
hellovoronezh.com hellovoronezh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
UA UA-121239807 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
TREM TREM-J54V6-5C8FF Jun 2019 Jun 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloakron.com helloakron.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 129 days
ORC ORC-963 Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
DM DM-101492 Jun 2019 Sep 2019 103 days
SVRN SVRN-265277 Jun 2019 Sep 2019 103 days
LIJI LIJI-265277 Jun 2019 Sep 2019 103 days
TREM TREM-J54V6-5C8FF Jun 2019 Sep 2019 103 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
UA UA-121239807 Jul 2019 Oct 2019 81 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
GTM GTM-AW-804755169 Jul 2019 Aug 2019 20 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
AOL AOL-6614 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
helloboise.com helloboise.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 129 days
AOL AOL-6614 Jun 2019 Oct 2019 129 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
DM DM-101492 Jun 2019 Oct 2019 129 days
SVRN SVRN-261774 Jun 2019 Oct 2019 129 days
LIJI LIJI-265277 Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
TREM TREM-J54V6-5C8FF Jul 2019 Oct 2019 81 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
ORC ORC-402 Jun 2019 Aug 2019 68 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
UA UA-121239807 Jul 2019 Sep 2019 55 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 Sep 2019 Oct 2019 26 days
ORC ORC-963 Sep 2019 Oct 2019 26 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
helloenid.com helloenid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
hellomontgomery.com hellomontgomery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 130 days
DM DM-101492 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
SVRN SVRN-261774 Jul 2019 Oct 2019 82 days
LIJI LIJI-265277 Jul 2019 Oct 2019 82 days
ORC ORC-963 Jul 2019 Oct 2019 82 days
CA CA-PUB-8425488243879801 May 2019 Jul 2019 77 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
UA UA-121239807 May 2019 Jun 2019 29 days
DM DM-100974 Jul 2019 Aug 2019 21 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
AOL AOL-6614 Jul 2019 Jul 2019 One Off
hellolatrobe.com hellolatrobe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
LIJI LIJI-265277 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
hellolehi.com hellolehi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
hellotoledo.com hellotoledo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 Apr 2019 Aug 2019 121 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
ORC ORC-963 Jul 2019 Oct 2019 81 days
TREM TREM-J54V6-5C8FF Jul 2019 Oct 2019 81 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
CONN CONN-102738 Jul 2019 Oct 2019 81 days
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 81 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
DM DM-101492 Sep 2019 Oct 2019 26 days
AOL AOL-6748 Sep 2019 Oct 2019 26 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 22 days
DM DM-100974 Jul 2019 Aug 2019 20 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellomarlborough.com hellomarlborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellomaui.com hellomaui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
hellosarajevo.com hellosarajevo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
hellocanton.com hellocanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SVRN SVRN-265277 Jun 2019 Oct 2019 129 days
LIJI LIJI-265277 Jun 2019 Oct 2019 129 days
ORC ORC-963 Jun 2019 Oct 2019 129 days
AOL AOL-6614 Jun 2019 Oct 2019 129 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 129 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
UA UA-121239807 Jul 2019 Oct 2019 81 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
DM DM-100974 Jun 2019 Aug 2019 68 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
DM DM-101492 Sep 2019 Oct 2019 26 days
GTM GTM-AW-804755169 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
hellogalveston.com hellogalveston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Sep 2019 133 days
DM DM-101492 Jul 2019 Oct 2019 81 days
SVRN SVRN-265277 Jul 2019 Oct 2019 81 days
ORC ORC-963 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
CONN CONN-102738 Jul 2019 Oct 2019 81 days
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 81 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
SVRN SVRN-261774 Sep 2019 Oct 2019 26 days
LIJI LIJI-265277 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Oct 2018 Oct 2018 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
hellomanhattan.com hellomanhattan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
AOL AOL-6614 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
GTM GTM-UA-121239807-2 Jul 2019 Oct 2019 81 days
SVRN SVRN-265277 Jul 2019 Oct 2019 81 days
ORC ORC-963 Jul 2019 Oct 2019 81 days
CONN CONN-102738 Jul 2019 Oct 2019 81 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 81 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jul 2019 Sep 2019 55 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
DM DM-101492 Sep 2019 Oct 2019 26 days
IEX IEX-189205 Sep 2019 Oct 2019 26 days
TREM TREM-J54V6-5C8FF Sep 2019 Oct 2019 26 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 22 days
DM DM-100974 Jul 2019 Aug 2019 20 days
GTM GTM-AW-804755169 Jul 2019 Aug 2019 20 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Sep 2019 Sep 2019 One Off
hellocincinnati.com hellocincinnati.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CONN CONN-102738 Jul 2019 Oct 2019 81 days
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 81 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-101492 Jul 2019 Sep 2019 55 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 Sep 2019 Oct 2019 26 days
LIJI LIJI-265277 Sep 2019 Oct 2019 26 days
SVRN SVRN-265277 Sep 2019 Oct 2019 26 days
AOL AOL-11647 Sep 2019 Oct 2019 26 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
AOL AOL-6748 Jul 2019 Jul 2019 One Off
SVRN SVRN-261774 Jul 2019 Jul 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
hellosaltlakecity.com hellosaltlakecity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Oct 2018 Aug 2019 300 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 Jul 2019 Oct 2019 81 days
DM DM-101492 Jul 2019 Oct 2019 81 days
SVRN SVRN-265277 Jul 2019 Oct 2019 81 days
LIJI LIJI-265277 Jul 2019 Oct 2019 81 days
AOL AOL-6748 Jul 2019 Oct 2019 81 days
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
TREM TREM-J54V6-5C8FF Jul 2019 Oct 2019 81 days
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
CONN CONN-102738 Jul 2019 Oct 2019 81 days
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 81 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
SVRN SVRN-261774 Sep 2019 Oct 2019 26 days
ORC ORC-963 Sep 2019 Oct 2019 26 days
AOL AOL-11647 Sep 2019 Oct 2019 26 days
FWHL FWHL-970193 Sep 2019 Oct 2019 26 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
hellosarasota.com hellosarasota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 129 days
LIJI LIJI-265277 Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
ORC ORC-963 Jun 2019 Oct 2019 129 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 129 days
AOL AOL-6614 Jun 2019 Oct 2019 129 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
DM DM-100974 Jun 2019 Aug 2019 68 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
TEAD TEAD-16544 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
TELA TELA-457 Sep 2019 Oct 2019 26 days
AVVID AVVID-7802 Sep 2019 Oct 2019 26 days
YUME YUME-4016333178 Sep 2019 Oct 2019 26 days
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
GUMG GUMG-13810 Sep 2019 Oct 2019 26 days
PRIM PRIM-19139 Sep 2019 Oct 2019 26 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 22 days
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Jun 2019 Jun 2019 One Off
DM DM-101492 Sep 2019 Sep 2019 One Off
hellobirmingham.com hellobirmingham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
UA UA-121239807 Jul 2019 Oct 2019 82 days
SVRN SVRN-265277 Jul 2019 Oct 2019 82 days
LIJI LIJI-265277 Jul 2019 Oct 2019 82 days
DM DM-101492 Jul 2019 Oct 2019 82 days
ORC ORC-963 Jul 2019 Oct 2019 82 days
AOL AOL-6748 Jul 2019 Oct 2019 82 days
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
CONN CONN-102738 Jul 2019 Oct 2019 82 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 82 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellobountiful.com hellobountiful.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
CA CA-PUB-8425488243879801 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
helloreno.com helloreno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Oct 2018 Aug 2019 300 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
LIJI LIJI-265277 Jul 2019 Oct 2019 81 days
TREM TREM-J54V6-5C8FF Jul 2019 Oct 2019 81 days
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
CONN CONN-102738 Jul 2019 Oct 2019 81 days
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 81 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-11647 Aug 2019 Sep 2019 35 days
GTM GTM-UA-121239807-2 Sep 2019 Oct 2019 26 days
SVRN SVRN-265277 Sep 2019 Oct 2019 26 days
DM DM-100974 Jul 2019 Aug 2019 20 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
DM DM-101492 Sep 2019 Sep 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
helloelko.com helloelko.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
hellosyracuse.com hellosyracuse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 Sep 2018 Aug 2019 330 days
GTM GTM-UA-121239807-2 Jul 2019 Oct 2019 81 days
CA CA-PUB-8425488243879801 Jul 2019 Oct 2019 81 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
DM DM-101492 Jul 2019 Oct 2019 81 days
CONN CONN-102738 Jul 2019 Oct 2019 81 days
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 81 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 36 days
ORC ORC-963 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
NEX NEX-3391 Jul 2019 Aug 2019 20 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
helloderby.com helloderby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
helloalbuquerque.com helloalbuquerque.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
UA UA-121239807 Jul 2019 Oct 2019 81 days
DM DM-101492 Jul 2019 Oct 2019 81 days
SVRN SVRN-261774 Jul 2019 Oct 2019 81 days
LIJI LIJI-265277 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
CONN CONN-102738 Jul 2019 Oct 2019 81 days
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Oct 2019 81 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jul 2019 Sep 2019 55 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-6614 Sep 2019 Oct 2019 26 days
FWHL FWHL-970193 Sep 2019 Oct 2019 26 days
TREM TREM-J54V6-5C8FF Sep 2019 Oct 2019 26 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 13 days
hellohamptonroads.com hellohamptonroads.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
AOL AOL-6748 Jun 2019 Oct 2019 129 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
DM DM-101492 Jun 2019 Oct 2019 129 days
SVRN SVRN-265277 Jun 2019 Oct 2019 129 days
LIJI LIJI-265277 Jun 2019 Oct 2019 129 days
CONN CONN-102738 Jun 2019 Oct 2019 129 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 129 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
ORC ORC-963 Jun 2019 Jul 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
NEX NEX-3391 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellomiami.com hellomiami.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 130 days
LIJI LIJI-265277 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GUMG GUMG-13810 Sep 2019 Oct 2019 26 days
YUME YUME-4016333178 Sep 2019 Oct 2019 26 days
TEAD TEAD-16544 Sep 2019 Oct 2019 26 days
PRIM PRIM-19139 Sep 2019 Oct 2019 26 days
IEX IEX-189205 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 26 days
TELA TELA-457 Sep 2019 Oct 2019 26 days
AVVID AVVID-7802 Sep 2019 Oct 2019 26 days
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
ORC ORC-963 Sep 2019 Sep 2019 One Off
helloglenellyn.com helloglenellyn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
hellonairobi.com hellonairobi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
helloquanzhou.com helloquanzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
TEAD TEAD-16544 Oct 2019 Oct 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
TELA TELA-457 Oct 2019 Oct 2019 One Off
AVVID AVVID-7802 Oct 2019 Oct 2019 One Off
CONN CONN-102738 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Oct 2019 One Off
YUME YUME-4016333178 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
GUMG GUMG-13810 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
helloshantou.com helloshantou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
TEAD TEAD-16544 Oct 2019 Oct 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
TELA TELA-457 Oct 2019 Oct 2019 One Off
AVVID AVVID-7802 Oct 2019 Oct 2019 One Off
CONN CONN-102738 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Oct 2019 One Off
YUME YUME-4016333178 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
GUMG GUMG-13810 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
hellosoho.com hellosoho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Jun 2019 Oct 2019 111 days
ORC ORC-402 May 2019 Aug 2019 98 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
SVRN SVRN-261774 May 2019 May 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
helloperm.com helloperm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
TEAD TEAD-16544 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
TELA TELA-457 Oct 2019 Oct 2019 One Off
AVVID AVVID-7802 Oct 2019 Oct 2019 One Off
CONN CONN-102738 Oct 2019 Oct 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Oct 2019 One Off
YUME YUME-4016333178 Oct 2019 Oct 2019 One Off
GUMG GUMG-13810 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
hellonouakchott.com hellonouakchott.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Mar 2020 Jan 2021 298 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
TEAD TEAD-16544 Oct 2019 Oct 2019 One Off
SVRN SVRN-261774 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
TELA TELA-457 Oct 2019 Oct 2019 One Off
AVVID AVVID-7802 Oct 2019 Oct 2019 One Off
CONN CONN-102738 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Oct 2019 One Off
YUME YUME-4016333178 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
GUMG GUMG-13810 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
hellosaintbarthelemy.com hellosaintbarthelemy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
TEAD TEAD-16544 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
TELA TELA-457 Oct 2019 Oct 2019 One Off
AVVID AVVID-7802 Oct 2019 Oct 2019 One Off
CONN CONN-102738 Oct 2019 Oct 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Oct 2019 One Off
YUME YUME-4016333178 Oct 2019 Oct 2019 One Off
GUMG GUMG-13810 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
helloalaska.com helloalaska.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
CA CA-PUB-8425488243879801 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
helloiowa.com helloiowa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
hellodinuba.com hellodinuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
DM DM-100974 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Jun 2019 Jun 2019 One Off
SVRN SVRN-265277 Jun 2019 Jun 2019 One Off
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
LIJI LIJI-265277 Jun 2019 Jun 2019 One Off
ORC ORC-402 Jun 2019 Jun 2019 One Off
ORC ORC-963 Jun 2019 Jun 2019 One Off
AOL AOL-6614 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
TREM TREM-J54V6-5C8FF Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CU7QPX3O Jun 2019 Jun 2019 One Off
CONN CONN-102738 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Jun 2019 One Off
hellopharr.com hellopharr.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
TEAD TEAD-16544 Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
TELA TELA-457 Oct 2019 Oct 2019 One Off
AVVID AVVID-7802 Oct 2019 Oct 2019 One Off
CONN CONN-102738 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Oct 2019 One Off
YUME YUME-4016333178 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
GUMG GUMG-13810 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
hellochambersburgborough.com hellochambersburgborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellohelsinki.com hellohelsinki.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-121239807-2 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Jun 2019 Oct 2019 111 days
LIJI LIJI-265277 Jun 2019 Oct 2019 111 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
CONN CONN-102738 Jun 2019 Oct 2019 111 days
SONO SONO-783272317B Jun 2019 Oct 2019 111 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Aug 2019 50 days
ORC ORC-402 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellogeneva.com hellogeneva.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 May 2019 May 2019 One Off
DM DM-100974 May 2019 May 2019 One Off
NEX NEX-3391 May 2019 May 2019 One Off
SVRN SVRN-261774 May 2019 May 2019 One Off
ORC ORC-963 May 2019 May 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
CONN CONN-102738 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 May 2019 One Off
hellokennesaw.com hellokennesaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Jan 2014 1 year, 317 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
hellobishkek.com hellobishkek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
hellochelyabinsk.com hellochelyabinsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellovitebsk.com hellovitebsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloaligarh.com helloaligarh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellokaduna.com hellokaduna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellokobe.com hellokobe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
helloliuzhou.com helloliuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
hellotomsk.com hellotomsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellobari.com hellobari.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellodonetsk.com hellodonetsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellobilbao.com hellobilbao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellobozhou.com hellobozhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
hellobrno.com hellobrno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellobryansk.com hellobryansk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellocotonou.com hellocotonou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
helloguangzhou.com helloguangzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
helloirkutsk.com helloirkutsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellorugao.com hellorugao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloulyanovsk.com helloulyanovsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
helloyichun.com helloyichun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloblagoveshchensk.com helloblagoveshchensk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellocantho.com hellocantho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
GTM GTM-UA-121239807-2 May 2019 May 2019 One Off
hellohezhou.com hellohezhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
hellokryvyirih.com hellokryvyirih.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellorizhao.com hellorizhao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
theweek.com theweek.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
dexerto.fr dexerto.fr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Sep 2019 149 days
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 149 days
ORC ORC-402 Jun 2019 Aug 2019 57 days
DM DM-100974 Jun 2019 Aug 2019 49 days
SONO SONO-783272317B Jun 2019 Aug 2019 49 days
FWHL FWHL-762737 May 2019 Jun 2019 41 days
hellobamako.com hellobamako.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellobarcelona.com hellobarcelona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobristol.com hellobristol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobrussels.com hellobrussels.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobudapest.com hellobudapest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloconakry.com helloconakry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocopenhagen.com hellocopenhagen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocorinth.com hellocorinth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocostarica.com hellocostarica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloharbin.com helloharbin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloilorin.com helloilorin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloindonesia.com helloindonesia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloinnsbruck.com helloinnsbruck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellokaragandy.com hellokaragandy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellokatowice.com hellokatowice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokhabarovsk.com hellokhabarovsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellokinshasa.com hellokinshasa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokoln.com hellokoln.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloluanda.com helloluanda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellolubumbashi.com hellolubumbashi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolugansk.com hellolugansk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellomunster.com hellomunster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Mar 2014 2 years, 14 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 24 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 24 days
hellonuremberg.com hellonuremberg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloparis.com helloparis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellophilippines.com hellophilippines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloportoalegre.com helloportoalegre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloprague.com helloprague.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopuertovallarta.com hellopuertovallarta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellopusan.com hellopusan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellorabat.com hellorabat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloreykjavik.com helloreykjavik.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorybinsk.com hellorybinsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellostrasbourg.com hellostrasbourg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellothunderbay.com hellothunderbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Nov 2021 Sep 2022 294 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotoronto.com hellotoronto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellotripoli.com hellotripoli.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jul 2020 Jan 2021 188 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
dexerto.com dexerto.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Sep 2019 149 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 90 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
floridatravellife.com floridatravellife.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloabidjan.com helloabidjan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobards.com hellobards.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jan 2022 187 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobelarus.com hellobelarus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellobogota.com hellobogota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellobordeaux.com hellobordeaux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobrantford.com hellobrantford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellobrisbane.com hellobrisbane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocairo.com hellocairo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellochangchun.com hellochangchun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellochangsha.com hellochangsha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellochristchurch.com hellochristchurch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloguatemalacity.com helloguatemalacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohamburg.com hellohamburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellohuzhou.com hellohuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
hellokolwezi.com hellokolwezi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokyoto.com hellokyoto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellolinz.com hellolinz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
hellolusaka.com hellolusaka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
UA UA-350746 Feb 2012 Feb 2012 One Off
hellomainz.com hellomainz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
hellomontreal.com hellomontreal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloosaka.com helloosaka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellorajkot.com hellorajkot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloastana.com helloastana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
helloaustria.com helloaustria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
hellobremen.com hellobremen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobuenosaires.com hellobuenosaires.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocapetown.com hellocapetown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellocasablanca.com hellocasablanca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodouala.com hellodouala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodusseldorf.com hellodusseldorf.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloedinburg.com helloedinburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloglasgow.com helloglasgow.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohamadtown.com hellohamadtown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellojakarta.com hellojakarta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellokiel.com hellokiel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolapaz.com hellolapaz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloliverpool.com helloliverpool.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomaputo.com hellomaputo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellomilan.com hellomilan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomonterrey.com hellomonterrey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloportharcourt.com helloportharcourt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosalzburg.com hellosalzburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosapporo.com hellosapporo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellotoulouse.com hellotoulouse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellovenice.com hellovenice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
helloyaounde.com helloyaounde.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
motorcyclecruiser.com motorcyclecruiser.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
puckermob.com puckermob.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
AOL AOL-6748 Jul 2019 Oct 2019 82 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-6614 Jun 2019 Jul 2019 48 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hellobenghazi.com hellobenghazi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
hellobrasov.com hellobrasov.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
hellobucharest.com hellobucharest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellocologne.com hellocologne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocordoba.com hellocordoba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloessen.com helloessen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloflorence.com helloflorence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
helloheidelberg.com helloheidelberg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellohuazhou.com hellohuazhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
hellojohannesburg.com hellojohannesburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokanpur.com hellokanpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
hellokitchener.com hellokitchener.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokrasnoyarsk.com hellokrasnoyarsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellolahore.com hellolahore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolipetsk.com hellolipetsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellomagnitogorsk.com hellomagnitogorsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
hellomelbourne.com hellomelbourne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomexicocity.com hellomexicocity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomontecarlo.com hellomontecarlo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellomoscow.com hellomoscow.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomurmansk.com hellomurmansk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellooslo.com hellooslo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloperth.com helloperth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellorio.com hellorio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloriodejaneiro.com helloriodejaneiro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosaguenay.com hellosaguenay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosalvador.com hellosalvador.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosantiago.com hellosantiago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118129358-1 Dec 2019 Jan 2021 1 year, 32 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosydney.com hellosydney.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellotakhmau.com hellotakhmau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellovancouver.com hellovancouver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellovictoria.com hellovictoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 24 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
hellozurich.com hellozurich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
atvrider.com atvrider.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
baseballessential.com baseballessential.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
boatingmag.com boatingmag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Jul 2019 48 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
cyclevolta.com cyclevolta.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 108 days
FWHL FWHL-762769 Aug 2019 Sep 2019 59 days
ORC ORC-402 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
dailydot.com dailydot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
dexerto.es dexerto.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Sep 2019 149 days
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 108 days
SONO SONO-783272317B Jun 2019 Sep 2019 108 days
DM DM-100974 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
flyingmag.com flyingmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
helloalbertlea.com helloalbertlea.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
helloalgiers.com helloalgiers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellobaotou.com hellobaotou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobarquisimeto.com hellobarquisimeto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobelem.com hellobelem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobursa.com hellobursa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocebucity.com hellocebucity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellochangzhou.com hellochangzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloclujnapoca.com helloclujnapoca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodammam.com hellodammam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodresden.com hellodresden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloecatepec.com helloecatepec.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
helloezhou.com helloezhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
hellogaozhou.com hellogaozhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogomel.com hellogomel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogreatersudbury.com hellogreatersudbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogreatfalls.com hellogreatfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellohonduras.com hellohonduras.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloidahofalls.com helloidahofalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellojeffersonville.com hellojeffersonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellojoliet.com hellojoliet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellokabul.com hellokabul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
hellokaliningrad.com hellokaliningrad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokhartoum.com hellokhartoum.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellokirov.com hellokirov.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokitakyushu.com hellokitakyushu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Nov 2018 Nov 2018 One Off
hellokitwe.com hellokitwe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellolaplata.com hellolaplata.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloluzhou.com helloluzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomagdeburg.com hellomagdeburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomalmo.com hellomalmo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomanama.com hellomanama.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomanaus.com hellomanaus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomedicinehat.com hellomedicinehat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Oct 2020 2 years, 20 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomosul.com hellomosul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomountjuliet.com hellomountjuliet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellonovaiguacu.com hellonovaiguacu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloopelousas.com helloopelousas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloorenburg.com helloorenburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopalikir.com hellopalikir.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopostfalls.com hellopostfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellorochesterhills.com hellorochesterhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellosansalvador.com hellosansalvador.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Oct 2020 2 years, 58 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellotegucigalpa.com hellotegucigalpa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloteheran.com helloteheran.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellotengzhou.com hellotengzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotientsin.com hellotientsin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloturin.com helloturin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellovalletta.com hellovalletta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellovarna.com hellovarna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellovisakhapatnam.com hellovisakhapatnam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowoodbuffalo.com hellowoodbuffalo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloxintai.com helloxintai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
saveur.com saveur.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
ORC ORC-402 Jun 2019 Jun 2019 One Off
shnc.co.uk shnc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Sep 2019 100 days
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 48 days
DM DM-100974 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
baggersmag.com baggersmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
DM DM-100974 Jul 2019 Jul 2019 One Off
workingmother.com workingmother.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
yachtingmagazine.com yachtingmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloaccra.com helloaccra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloalmaty.com helloalmaty.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellobraila.com hellobraila.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobucaramanga.com hellobucaramanga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocamas.com hellocamas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocampinas.com hellocampinas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellociudadguayana.com hellociudadguayana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocoquitlam.com hellocoquitlam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocozumel.com hellocozumel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloedina.com helloedina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellofoshan.com hellofoshan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofreeport.com hellofreeport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 May 2016 2 years, 209 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellogretna.com hellogretna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
helloguatemala.com helloguatemala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellohubli.com hellohubli.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloibadan.com helloibadan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellojoaopessoa.com hellojoaopessoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellojuneau.com hellojuneau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokanazawa.com hellokanazawa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokano.com hellokano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokaraj.com hellokaraj.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellolima.com hellolima.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomelekeok.com hellomelekeok.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomogilev.com hellomogilev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomuscat.com hellomuscat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonewmarket.com hellonewmarket.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellonezahualcoyotl.com hellonezahualcoyotl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloniigata.com helloniigata.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopalermo.com hellopalermo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopalmettobay.com hellopalmettobay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloportelizabeth.com helloportelizabeth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloquito.com helloquito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellorosario.com hellorosario.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorotherham.com hellorotherham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloshishi.com helloshishi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloshizuoka.com helloshizuoka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosuzhouanhui.com hellosuzhouanhui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotaizhou.com hellotaizhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotallinn.com hellotallinn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowakefield.com hellowakefield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowroclaw.com hellowroclaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloyekaterinburg.com helloyekaterinburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellozapopan.com hellozapopan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellozhangjiakou.com hellozhangjiakou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
mapsofworld.com mapsofworld.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
paypath.com paypath.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 Aug 2019 83 days
DM DM-100974 May 2019 Jul 2019 47 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
NEX NEX-3391 May 2019 May 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
scubadiving.com scubadiving.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
streetchopperweb.com streetchopperweb.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
theodysseyonline.com theodysseyonline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
diyphotography.net diyphotography.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloacapulco.com helloacapulco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloaltus.com helloaltus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 254 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloaqaba.com helloaqaba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloathens.com helloathens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloatlanticcity.com helloatlanticcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellobanjul.com hellobanjul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
hellobelgrade.com hellobelgrade.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloberea.com helloberea.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
helloberlin.com helloberlin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellochangshu.com hellochangshu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-AW-804755169 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellochennai.com hellochennai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellochinohills.com hellochinohills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellociudadjuarez.com hellociudadjuarez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocixi.com hellocixi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocorona.com hellocorona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellodavaocity.com hellodavaocity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellodongtai.com hellodongtai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloerdenet.com helloerdenet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellofountainhills.com hellofountainhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellogatineau.com hellogatineau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Dec 2019 Jan 2021 1 year, 32 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogent.com hellogent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloguarulhos.com helloguarulhos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohavana.com hellohavana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellojixi.com hellojixi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellojodhpur.com hellojodhpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
hellokaluga.com hellokaluga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolimerick.com hellolimerick.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolubeck.com hellolubeck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomontegobay.com hellomontegobay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloqiqihar.com helloqiqihar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorome.com hellorome.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellorostock.com hellorostock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosochi.com hellosochi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosurakarta.com hellosurakarta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotirana.com hellotirana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellotoluca.com hellotoluca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellovernonhills.com hellovernonhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellowichitafalls.com hellowichitafalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
helloxuzhou.com helloxuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloyaroslavl.com helloyaroslavl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellozaria.com hellozaria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellozhengzhou.com hellozhengzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
scarymommy.com scarymommy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 130 days
AOL AOL-6748 Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
sizzlepixs.com sizzlepixs.com
Attribute Value First Detected Last Detected Overlap Duration
CONN CONN-102738 May 2019 Oct 2019 138 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Sep 2019 Oct 2019 39 days
TREM TREM-J54V6-5C8FF Sep 2019 Oct 2019 39 days
wakeboardingmag.com wakeboardingmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
cycleworld.com cycleworld.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
DM DM-100974 Jun 2019 Jul 2019 48 days
ORC ORC-402 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
denofgeek.com denofgeek.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
dgreetings.com dgreetings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
IEX IEX-189205 Sep 2019 Oct 2019 26 days
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
fieldandstream.com fieldandstream.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
ORC ORC-402 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
helloallahabad.com helloallahabad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobangui.com hellobangui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellobelmopan.com hellobelmopan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobijie.com hellobijie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobissau.com hellobissau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobochum.com hellobochum.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocairns.com hellocairns.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellocancun.com hellocancun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocedarcity.com hellocedarcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellochisinau.com hellochisinau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellocolumbiaheights.com hellocolumbiaheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Oct 2013 Oct 2013 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodunlaoghaire.com hellodunlaoghaire.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofrankfurt.com hellofrankfurt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellofukuoka.com hellofukuoka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohamamatsu.com hellohamamatsu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohermosillo.com hellohermosillo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohiroshima.com hellohiroshima.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohohhot.com hellohohhot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloivanovo.com helloivanovo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellojinzhou.com hellojinzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokawasaki.com hellokawasaki.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokiev.com hellokiev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellokrasnodar.com hellokrasnodar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokualalumpur.com hellokualalumpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
hellokumamoto.com hellokumamoto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellolaizhou.com hellolaizhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolasi.com hellolasi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellomexicali.com hellomexicali.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomirat.com hellomirat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomosspoint.com hellomosspoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomunich.com hellomunich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonakhonratchasima.com hellonakhonratchasima.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Jul 2022 315 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonassau.com hellonassau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonicosia.com hellonicosia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 63 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellononthaburi.com hellononthaburi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Dec 2019 Jan 2021 1 year, 32 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloogbomosho.com helloogbomosho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 May 2019 May 2019 One Off
GTM GTM-UA-121239807-2 May 2019 May 2019 One Off
hellopaloshills.com hellopaloshills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Apr 2014 2 years, 42 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellopodgorica.com hellopodgorica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloprospect.com helloprospect.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloquebeccity.com helloquebeccity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloquezoncity.com helloquezoncity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloriffa.com helloriffa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosaanich.com hellosaanich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosalinas.com hellosalinas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosanpaulo.com hellosanpaulo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloseongnam.com helloseongnam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosomerset.com hellosomerset.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellostpetersburg.com hellostpetersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotongzhou.com hellotongzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotunis.com hellotunis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
mapsofindia.com mapsofindia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
popphoto.com popphoto.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
ORC ORC-402 Jul 2019 Jul 2019 One Off
allfreecrochetafghanpatterns.com allfreecrochetafghanpatterns.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
sufcacademy.com sufcacademy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 47 days
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
ORC ORC-402 May 2019 May 2019 One Off
swellinfo.com swellinfo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
thefader.com thefader.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
thehuddle.com thehuddle.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
twinfinite.net twinfinite.net
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 68 days
DM DM-100974 Jun 2019 Jul 2019 48 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
billboard.com billboard.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
catfish1.com catfish1.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
doityourself.com doityourself.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
ebaumsworld.com ebaumsworld.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
elections.in elections.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
fashionbeans.com fashionbeans.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
federaltimes.com federaltimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
fieldandstreamexpo.com fieldandstreamexpo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Jun 2019 45 days
DM DM-100974 Aug 2019 Aug 2019 3 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
floor8.com floor8.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
DM DM-100974 May 2019 Jun 2019 45 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
fstoppers.com fstoppers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
haccricket.org haccricket.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jun 2019 48 days
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
helloaltoona.com helloaltoona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloanchorage.com helloanchorage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloannapolis.com helloannapolis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloashgabat.com helloashgabat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloaspen.com helloaspen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloatlanta.com helloatlanta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloauckland.com helloauckland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobakersfield.com hellobakersfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobaltimore.com hellobaltimore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobarranquilla.com hellobarranquilla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobatonrouge.com hellobatonrouge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobermuda.com hellobermuda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobethesda.com hellobethesda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobloomingdale.com hellobloomingdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloboulder.com helloboulder.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 24 days
helloboyntonbeach.com helloboyntonbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobroomfield.com hellobroomfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellobrossard.com hellobrossard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobrownsburg.com hellobrownsburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocapecoral.com hellocapecoral.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocedarburg.com hellocedarburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocentralpoint.com hellocentralpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellocharleroi.com hellocharleroi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocharlotte.com hellocharlotte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellochatham-kent.com hellochatham-kent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellochesapeake.com hellochesapeake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocuritiba.com hellocuritiba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellodamascus.com hellodamascus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodarien.com hellodarien.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodeerfieldbeach.com hellodeerfieldbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodeerpark.com hellodeerpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodepere.com hellodepere.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodublin.com hellodublin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloduluth.com helloduluth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloeastmoline.com helloeastmoline.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloeastpoint.com helloeastpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloeugene.com helloeugene.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofargo.com hellofargo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellofortwayne.com hellofortwayne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofremont.com hellofremont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofullerton.com hellofullerton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogardner.com hellogardner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogatlinburg.com hellogatlinburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogerman.com hellogerman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jun 2020 1 year, 305 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
GTM GTM-UA-118129358-1 Jun 2020 Jun 2020 One Off
hellogloucester.com hellogloucester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogoleta.com hellogoleta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellogoodyear.com hellogoodyear.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellograndprairie.com hellograndprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellogrodno.com hellogrodno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloharlingen.com helloharlingen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohavelock.com hellohavelock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-350746 Feb 2012 Feb 2012 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohuntingtonpark.com hellohuntingtonpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-350746 Oct 2013 Oct 2013 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellojalandhar.com hellojalandhar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokeywest.com hellokeywest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
UA UA-350746 Feb 2012 Feb 2012 One Off
hellolagunaniguel.com hellolagunaniguel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolamirada.com hellolamirada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolaredo.com hellolaredo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolinolakes.com hellolinolakes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolisbon.com hellolisbon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolongmont.com hellolongmont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellolowell.com hellolowell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolubbock.com hellolubbock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellolynchburg.com hellolynchburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellomaceio.com hellomaceio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomamaroneck.com hellomamaroneck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomanila.com hellomanila.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomarana.com hellomarana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomargate.com hellomargate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellombabane.com hellombabane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellomemphis.com hellomemphis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomesquite.com hellomesquite.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomoraga.com hellomoraga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellomorenovalley.com hellomorenovalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomuharraq.com hellomuharraq.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellonanchang.com hellonanchang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellonewport.com hellonewport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonorthfield.com hellonorthfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellooceancity.com hellooceancity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloolathe.com helloolathe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloopelika.com helloopelika.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellootsego.com hellootsego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopicayune.com hellopicayune.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopleasantgrove.com hellopleasantgrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloplovdiv.com helloplovdiv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
helloponca.com helloponca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellorawalpindi.com hellorawalpindi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloraymore.com helloraymore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellorevere.com hellorevere.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloriverside.com helloriverside.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellorohnertpark.com hellorohnertpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloromulus.com helloromulus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloroundrock.com helloroundrock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosafetyharbor.com hellosafetyharbor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosanangelo.com hellosanangelo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosanbernardino.com hellosanbernardino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosantaana.com hellosantaana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloscottsdale.com helloscottsdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosiouxcity.com hellosiouxcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloskokie.com helloskokie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosmyrna.com hellosmyrna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosouthaven.com hellosouthaven.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosulphur.com hellosulphur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
hellosunprairie.com hellosunprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellotaiyuan.com hellotaiyuan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellotonga.com hellotonga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellotwinsburg.com hellotwinsburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellovail.com hellovail.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellovalparaiso.com hellovalparaiso.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellovanburen.com hellovanburen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellovientiane.com hellovientiane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellovirginiabeach.com hellovirginiabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellowestlafayette.com hellowestlafayette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowoodlandhills.com hellowoodlandhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowoodstock.com hellowoodstock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloyork.com helloyork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
highdefdigest.com highdefdigest.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
historynet.com historynet.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hollywoodreporter.com hollywoodreporter.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
jplay.com.au jplay.com.au
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 154 days
DM DM-100974 May 2019 Aug 2019 93 days
ORC ORC-402 May 2019 Aug 2019 93 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
maindy.co.uk maindy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
ORC ORC-402 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
ohiosportsman.com ohiosportsman.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Jul 2019 48 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
readpl.com readpl.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 Jul 2019 Aug 2019 33 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
readamericanfootball.com readamericanfootball.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
readtottenham.com readtottenham.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 33 days
ORC ORC-402 Jul 2019 Aug 2019 33 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
pcgamer.com pcgamer.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
piperforum.com piperforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
DM DM-100974 Jul 2019 Aug 2019 20 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
achoylake.com achoylake.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 80 days
DM DM-100974 May 2019 Jun 2019 32 days
SONO SONO-783272317B May 2019 Jun 2019 32 days
ORC ORC-402 Jun 2019 Jun 2019 One Off
airforcetimes.com airforcetimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
audizine.com audizine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
the-gadgeteer.com the-gadgeteer.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
thetechgame.com thetechgame.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
vinepair.com vinepair.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 69 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-100974 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dornob.com dornob.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
endurocross.com endurocross.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
everydaydiabeticrecipes.com everydaydiabeticrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
givemesport.com givemesport.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
gofugyourself.com gofugyourself.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloaberdeen.com helloaberdeen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloalmadabad.com helloalmadabad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloamarillo.com helloamarillo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloamritsar.com helloamritsar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloannarbor.com helloannarbor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloardmore.com helloardmore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloarlingtonheights.com helloarlingtonheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloavenal.com helloavenal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobaghdad.com hellobaghdad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobangdung.com hellobangdung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobeijing.com hellobeijing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobeiliu.com hellobeiliu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobelize.com hellobelize.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobielefeld.com hellobielefeld.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobismarck.com hellobismarck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobloomington.com hellobloomington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobradenton.com hellobradenton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocabot.com hellocabot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocaloocan.com hellocaloocan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellocedarrapids.com hellocedarrapids.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellochandler.com hellochandler.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Mar 2016 4 years, 31 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellochemnitz.com hellochemnitz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellochesterfield.com hellochesterfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloclevelandheights.com helloclevelandheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Oct 2013 Oct 2013 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodaniabeach.com hellodaniabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodenmark.com hellodenmark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Aug 2018 One Off
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodetroit.com hellodetroit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodownersgrove.com hellodownersgrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloduquedecaxias.com helloduquedecaxias.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloeldorado.com helloeldorado.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloellensburg.com helloellensburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloelsalvador.com helloelsalvador.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloevansville.com helloevansville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Mar 2016 4 years, 31 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofarmersbranch.com hellofarmersbranch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofayetteville.com hellofayetteville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloflint.com helloflint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofortwaltonbeach.com hellofortwaltonbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellofuxin.com hellofuxin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellogaborone.com hellogaborone.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellogateshead.com hellogateshead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloglendale.com helloglendale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellograyslake.com hellograyslake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogreenbay.com hellogreenbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloguadalajara.com helloguadalajara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogulfshores.com hellogulfshores.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogwangju.com hellogwangju.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellohannibal.com hellohannibal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohattiesburg.com hellohattiesburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 24 days
hellohayward.com hellohayward.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohelena.com hellohelena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloherriman.com helloherriman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloimperialbeach.com helloimperialbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Oct 2013 Oct 2014 353 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloindianapolis.com helloindianapolis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloiowacity.com helloiowacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloirvine.com helloirvine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellojerseycity.com hellojerseycity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokaunas.com hellokaunas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokumasi.com hellokumasi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellolamatanza.com hellolamatanza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloleeds.com helloleeds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloleipzig.com helloleipzig.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloliberal.com helloliberal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolittleton.com hellolittleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolivonia.com hellolivonia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellolongbeach.com hellolongbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolosangeles.com hellolosangeles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomanassaspark.com hellomanassaspark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomcallen.com hellomcallen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomequon.com hellomequon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomethuen.com hellomethuen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellominden.com hellominden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellominnetonka.com hellominnetonka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellomodesto.com hellomodesto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellomountainbrook.com hellomountainbrook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomuskogee.com hellomuskogee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellomyrtlebeach.com hellomyrtlebeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-121239807 Sep 2019 Sep 2019 One Off
GTM GTM-UA-121239807-2 Sep 2019 Sep 2019 One Off
hellonicholasville.com hellonicholasville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonorthplatte.com hellonorthplatte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonorthsaltlake.com hellonorthsaltlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellooaklandpark.com hellooaklandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellookayama.com hellookayama.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloorlando.com helloorlando.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloouterbanks.com helloouterbanks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloowatonna.com helloowatonna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopalmademallorca.com hellopalmademallorca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellopampa.com hellopampa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloperrysburg.com helloperrysburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloplano.com helloplano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopuebla.com hellopuebla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellopuertorico.com hellopuertorico.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopyongyang.com hellopyongyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellorepentigny.com hellorepentigny.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118129358 Mar 2022 May 2022 74 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloroanoke.com helloroanoke.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosalford.com hellosalford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosanfernando.com hellosanfernando.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellosanfrancisco.com hellosanfrancisco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosantaclarita.com hellosantaclarita.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellosantafe.com hellosantafe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloseattle.com helloseattle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloseguin.com helloseguin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosendai.com hellosendai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloshymkent.com helloshymkent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellosiouxfalls.com hellosiouxfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellospanishfork.com hellospanishfork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellospartanburg.com hellospartanburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellostuttgart.com hellostuttgart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
hellosuizhou.com hellosuizhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosuperior.com hellosuperior.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 254 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellotacoma.com hellotacoma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellothessaloniki.com hellothessaloniki.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellotianshui.com hellotianshui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellotopeka.com hellotopeka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowaco.com hellowaco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowestlinn.com hellowestlinn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowestpalmbeach.com hellowestpalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellowilmette.com hellowilmette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowinona.com hellowinona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowyandotte.com hellowyandotte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloyuba.com helloyuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
inhabitat.com inhabitat.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
kcmha.ca kcmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 106 days
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
list25.com list25.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
livescience.com livescience.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
marinecorpstimes.com marinecorpstimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
matadornetwork.com matadornetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
metalinjection.net metalinjection.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
parentingisnteasy.co parentingisnteasy.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
popdust.com popdust.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
ORC ORC-402 May 2019 Aug 2019 82 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
rabbitdogs.net rabbitdogs.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 81 days
ORC ORC-402 May 2019 Aug 2019 81 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
rwbhc.co.uk rwbhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 Jul 2019 47 days
DM DM-100974 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
sailingworld.com sailingworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
space.com space.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
12up.com 12up.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jul 2019 48 days
DM DM-100974 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
tomsguide.com tomsguide.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
tractorforum.com tractorforum.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jul 2019 48 days
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
tvbeurope.com tvbeurope.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 87 days
DM DM-100974 Jul 2019 Aug 2019 26 days
ORC ORC-402 Jul 2019 Jul 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
biggboss2.net biggboss2.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
FWHL FWHL-762769 Jun 2019 Oct 2019 123 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
PUBM PUBM-158017 Sep 2019 Oct 2019 17 days
utvdriver.com utvdriver.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 134 days
FWHL FWHL-762737 May 2019 Jul 2019 48 days
FWHL FWHL-762769 Sep 2019 Oct 2019 32 days
DM DM-100974 May 2019 May 2019 One Off
walterfootball.com walterfootball.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
wciu.com wciu.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
cookstr.com cookstr.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
cruisingworld.com cruisingworld.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jul 2019 Aug 2019 21 days
digitalcameraworld.com digitalcameraworld.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
fishstock.com fishstock.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
helloadelanto.com helloadelanto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloagra.com helloagra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloallenpark.com helloallenpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloanoka.com helloanoka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Jul 2014 2 years, 133 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloarequipa.com helloarequipa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloaugusta.com helloaugusta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellobali.com hellobali.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobangkok.com hellobangkok.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobasra.com hellobasra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobenbrook.com hellobenbrook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloblacksburg.com helloblacksburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobogra.com hellobogra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobowlinggreen.com hellobowlinggreen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobrigham.com hellobrigham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobrookpark.com hellobrookpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobrownsville.com hellobrownsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobullhead.com hellobullhead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloburbank.com helloburbank.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloburnaby.com helloburnaby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobydgoszcz.com hellobydgoszcz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocasselberry.com hellocasselberry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocaymanislands.com hellocaymanislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocheyenne.com hellocheyenne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellochiba.com hellochiba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocloquet.com hellocloquet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellocoralsprings.com hellocoralsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocorcoran.com hellocorcoran.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocrevecoeur.com hellocrevecoeur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
hellodanbury.com hellodanbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodaye.com hellodaye.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellodearbornheights.com hellodearbornheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Jan 2014 1 year, 317 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodelano.com hellodelano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodelraybeach.com hellodelraybeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Sep 2014 2 years, 196 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellodeltona.com hellodeltona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloeaglepass.com helloeaglepass.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloedinburgh.com helloedinburgh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloedmonton.com helloedmonton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloelmonte.com helloelmonte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloelreno.com helloelreno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloescondido.com helloescondido.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloeuless.com helloeuless.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellofairbanks.com hellofairbanks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloforestlake.com helloforestlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofortlauderdale.com hellofortlauderdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofranklinpark.com hellofranklinpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogainesville.com hellogainesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogibraltar.com hellogibraltar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellograndforks.com hellograndforks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogreenfield.com hellogreenfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellogujranwala.com hellogujranwala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellohamlake.com hellohamlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohamtramck.com hellohamtramck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohartford.com hellohartford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohialeahgardens.com hellohialeahgardens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohornlake.com hellohornlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-350746 Oct 2013 Oct 2013 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohouma.com hellohouma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloislamabad.com helloislamabad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Dec 2019 Jan 2021 1 year, 32 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellojamaica.com hellojamaica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellojohnsoncity.com hellojohnsoncity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokelso.com hellokelso.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokemerovo.com hellokemerovo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokermanshah.com hellokermanshah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloklamathfalls.com helloklamathfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloknoxville.com helloknoxville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokuna.com hellokuna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokursk.com hellokursk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellolafayette.com hellolafayette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolagrande.com hellolagrande.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolancaster.com hellolancaster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolaporte.com hellolaporte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolaspalmas.com hellolaspalmas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellolittlerock.com hellolittlerock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloloslunas.com helloloslunas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellomachesneypark.com hellomachesneypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomauldin.com hellomauldin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomeriden.com hellomeriden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomonticello.com hellomonticello.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellomoore.com hellomoore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomuskego.com hellomuskego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonaypyidaw.com hellonaypyidaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellonewark.com hellonewark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonewberg.com hellonewberg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonewnan.com hellonewnan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonewportrichey.com hellonewportrichey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonewsmyrnabeach.com hellonewsmyrnabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellonorthlittlerock.com hellonorthlittlerock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellooakforest.com hellooakforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellooklahomacity.com hellooklahomacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellookmulgee.com hellookmulgee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloorangeburg.com helloorangeburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellooshkosh.com hellooshkosh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellooxnard.com hellooxnard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellopanamacity.com hellopanamacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloparagould.com helloparagould.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Dec 2013 1 year, 289 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopeabody.com hellopeabody.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopinellaspark.com hellopinellaspark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopingdu.com hellopingdu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloportarthur.com helloportarthur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
helloporthueneme.com helloporthueneme.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloprovidence.com helloprovidence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
helloqom.com helloqom.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jan 2022 187 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloredondobeach.com helloredondobeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellorexburg.com hellorexburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloriverbank.com helloriverbank.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloroyalpalmbeach.com helloroyalpalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellosaintthomas.com hellosaintthomas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosalina.com hellosalina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosanantonio.com hellosanantonio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellosanbenito.com hellosanbenito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellosanluispotosi.com hellosanluispotosi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloselma.com helloselma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloseymour.com helloseymour.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 12 days
hellosouthfield.com hellosouthfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellostamford.com hellostamford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosteubenville.com hellosteubenville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosudan.com hellosudan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellotalladega.com hellotalladega.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellotampa.com hellotampa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotijuana.com hellotijuana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotula.com hellotula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellotulare.com hellotulare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellotulsa.com hellotulsa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellounitedkingdom.com hellounitedkingdom.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellouniversitypark.com hellouniversitypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellourbana.com hellourbana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloutrecht.com helloutrecht.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellovaldosta.com hellovaldosta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 254 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellovegas.com hellovegas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellovienna.com hellovienna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellovladimir.com hellovladimir.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellowakeforest.com hellowakeforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowarwick.com hellowarwick.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowestallis.com hellowestallis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowestpoint.com hellowestpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowestchicago.com hellowestchicago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowestcovina.com hellowestcovina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowestjordan.com hellowestjordan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Mar 2014 2 years, 14 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowichita.com hellowichita.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellowindsor.com hellowindsor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloyerevan.com helloyerevan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloyorbalinda.com helloyorbalinda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloyuzhou.com helloyuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hotbikeweb.com hotbikeweb.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Jul 2019 One Off
knowyourmeme.com knowyourmeme.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
libertyproject.com libertyproject.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 Aug 2019 90 days
SONO SONO-783272317B Jun 2019 Aug 2019 51 days
DM DM-100974 Jun 2019 Aug 2019 43 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
livestrong.com livestrong.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
michigan-sportsman.com michigan-sportsman.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
motorcyclistonline.com motorcyclistonline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
outdoorlife.com outdoorlife.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
politifact.com politifact.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
popsci.com popsci.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
poynter.org poynter.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
rawstory.com rawstory.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
readfulham.com readfulham.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
readtv.co readtv.co
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
readwsl.com readwsl.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
airlinepilotforums.com airlinepilotforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
smallbizdaily.com smallbizdaily.com
Attribute Value First Detected Last Detected Overlap Duration
CONN CONN-102738 Sep 2019 Sep 2019 One Off
TELA TELA-457 Sep 2019 Sep 2019 One Off
PRIM PRIM-19139 Sep 2019 Sep 2019 One Off
TREM TREM-J54V6-5C8FF Sep 2019 Sep 2019 One Off
arkansashunting.net arkansashunting.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
auto123.com auto123.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
thebestdessertrecipes.com thebestdessertrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
bagshotcc.co.uk bagshotcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 84 days
ORC ORC-402 May 2019 Jun 2019 35 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bleepingcomputer.com bleepingcomputer.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
ORC ORC-402 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
boomsbeat.com boomsbeat.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
wrestlinginc.com wrestlinginc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
ealingcc.co.uk ealingcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 50 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 42 days
SONO SONO-783272317B May 2019 Jun 2019 42 days
ORC ORC-402 Jun 2019 Jun 2019 One Off
ehow.co.uk ehow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
favequilts.com favequilts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
firearmstalk.com firearmstalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
friaryscouts.com friaryscouts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 60 days
DM DM-100974 Aug 2019 Aug 2019 3 days
ORC ORC-402 Aug 2019 Aug 2019 3 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
gamingsym.com gamingsym.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 2 days
DM DM-100974 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
gunandgame.com gunandgame.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 Aug 2019 98 days
DM DM-100974 Aug 2019 Aug 2019 1 day
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
heavy.com heavy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
helloagawam.com helloagawam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloalexandria.com helloalexandria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloaltamontesprings.com helloaltamontesprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloandover.com helloandover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloanqiu.com helloanqiu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloarizona.com helloarizona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
helloauburnhills.com helloauburnhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloavonlake.com helloavonlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobarnaul.com hellobarnaul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobasrah.com hellobasrah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobeaumont.com hellobeaumont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobellaire.com hellobellaire.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobeverlyhills.com hellobeverlyhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobocaraton.com hellobocaraton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloboston.com helloboston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobrazzaville.com hellobrazzaville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118129358 Apr 2022 Jul 2022 90 days
hellobrooklynpark.com hellobrooklynpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellobuffalo.com hellobuffalo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellobulawayo.com hellobulawayo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellocatania.com hellocatania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocathedral.com hellocathedral.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocarrboro.com hellocarrboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocedarpark.com hellocedarpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellochampaign.com hellochampaign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocheboksary.com hellocheboksary.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloclearwater.com helloclearwater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloclemson.com helloclemson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocochabamba.com hellocochabamba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellodayton.com hellodayton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodaytonabeach.com hellodaytonabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodesoto.com hellodesoto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodover.com hellodover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloduisburg.com helloduisburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloduncan.com helloduncan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodurham.com hellodurham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodyersburg.com hellodyersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloeastlake.com helloeastlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloedenprairie.com helloedenprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloelcerrito.com helloelcerrito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloelmwoodpark.com helloelmwoodpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloennis.com helloennis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloerie.com helloerie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloerlanger.com helloerlanger.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 254 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofairfield.com hellofairfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellofife.com hellofife.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloforestpark.com helloforestpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellofortworth.com hellofortworth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellofrontroyal.com hellofrontroyal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogarfieldheights.com hellogarfieldheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogolden.com hellogolden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogothenburg.com hellogothenburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellogreensboro.com hellogreensboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogreenville.com hellogreenville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogriffin.com hellogriffin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohaltonhills.com hellohaltonhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellohamilton.com hellohamilton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohamm.com hellohamm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloharrisburg.com helloharrisburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohermosabeach.com hellohermosabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloheze.com helloheze.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellohomerglen.com hellohomerglen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-350746 Oct 2013 Oct 2013 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellohongkong.com hellohongkong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohouston.com hellohouston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloithaca.com helloithaca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellojacksonhole.com hellojacksonhole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellojenks.com hellojenks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellojoplin.com hellojoplin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellojuarez.com hellojuarez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellokansascity.com hellokansascity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokharkiv.com hellokharkiv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokilleen.com hellokilleen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokingston.com hellokingston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokuwaitcity.com hellokuwaitcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellolaiwu.com hellolaiwu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellolakeforest.com hellolakeforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolakeinthehills.com hellolakeinthehills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolakezurich.com hellolakezurich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellolaquinta.com hellolaquinta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloleessummit.com helloleessummit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolemongrove.com hellolemongrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolindenhurst.com hellolindenhurst.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolomalinda.com hellolomalinda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellolongueuil.com hellolongueuil.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomandeville.com hellomandeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomanteca.com hellomanteca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomarietta.com hellomarietta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellomarinette.com hellomarinette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomedellin.com hellomedellin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomedina.com hellomedina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Jun 2014 2 years, 105 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomilwaukie.com hellomilwaukie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomiramar.com hellomiramar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomoorhead.com hellomoorhead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomortongrove.com hellomortongrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomoseslake.com hellomoseslake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomuncie.com hellomuncie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 May 2014 2 years, 77 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomykolaiv.com hellomykolaiv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellonampa.com hellonampa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellonaples.com hellonaples.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonewhaven.com hellonewhaven.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonewhope.com hellonewhope.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellonorthmankato.com hellonorthmankato.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellonorthogden.com hellonorthogden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonorway.com hellonorway.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellonovato.com hellonovato.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellooakpark.com hellooakpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloorangecounty.com helloorangecounty.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloorsk.com helloorsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellooverlandpark.com hellooverlandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopainesville.com hellopainesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopalmbeach.com hellopalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloparkforest.com helloparkforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopenza.com hellopenza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellophoenix.com hellophoenix.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopierre.com hellopierre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopittsfield.com hellopittsfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloplover.com helloplover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopomona.com hellopomona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloprichard.com helloprichard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloradford.com helloradford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellorichfield.com hellorichfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Jul 2014 2 years, 133 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloriverfalls.com helloriverfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellorockford.com hellorockford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloscarsdale.com helloscarsdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosereisaophoan.com hellosereisaophoan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloshangqiu.com helloshangqiu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosouthsaltlake.com hellosouthsaltlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellostafford.com hellostafford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellosunlandpark.com hellosunlandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellotallahassee.com hellotallahassee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellotarponsprings.com hellotarponsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellotempe.com hellotempe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellotexarkana.com hellotexarkana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellothecolony.com hellothecolony.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellotullahoma.com hellotullahoma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloutica.com helloutica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellovicksburg.com hellovicksburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellovilnius.com hellovilnius.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellovladivostok.com hellovladivostok.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellovolgograd.com hellovolgograd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellowarrensburg.com hellowarrensburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellowatauga.com hellowatauga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellowauwatosa.com hellowauwatosa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowellington.com hellowellington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowhitebearlake.com hellowhitebearlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloworcester.com helloworcester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellozaragoza.com hellozaragoza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hockeybuzz.com hockeybuzz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 158 days
SONO SONO-783272317B May 2019 Oct 2019 158 days
ORC ORC-402 May 2019 Aug 2019 97 days
DM DM-100974 Jun 2019 Aug 2019 49 days
huskermax.com huskermax.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Sep 2019 104 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
indiantelevision.com indiantelevision.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 26 days
inspiremore.com inspiremore.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
DM DM-100974 Jul 2019 Aug 2019 20 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
makingstarwars.net makingstarwars.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 129 days
SONO SONO-783272317B Jun 2019 Oct 2019 129 days
ORC ORC-402 Jun 2019 Aug 2019 68 days
DM DM-100974 Jun 2019 Aug 2019 68 days
nafe.com nafe.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 147 days
ORC ORC-402 May 2019 Aug 2019 86 days
FWHL FWHL-762737 May 2019 Aug 2019 86 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
natureworldnews.com natureworldnews.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
navytimes.com navytimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
nhra.com nhra.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
outdoorhub.com outdoorhub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
pavementsucks.com pavementsucks.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 144 days
ORC ORC-402 May 2019 Aug 2019 83 days
DM DM-100974 Jul 2019 Aug 2019 36 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
preparedsociety.com preparedsociety.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
readcardiff.com readcardiff.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 Jul 2019 Aug 2019 33 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
readlaliga.com readlaliga.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
readliverpoolfc.com readliverpoolfc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
recipechatter.com recipechatter.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
saskchallengecup.com saskchallengecup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
sciencetimes.com sciencetimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 20 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
seattlepi.com seattlepi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
shabiba.com shabiba.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 139 days
FWHL FWHL-762737 May 2019 Jul 2019 47 days
FWHL FWHL-762769 Sep 2019 Oct 2019 39 days
stlyrics.com stlyrics.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
synonym.com synonym.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
ORC ORC-402 Jun 2019 Jul 2019 48 days
DM DM-100974 Jun 2019 Jun 2019 One Off
thebiglead.com thebiglead.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
thegoatspot.net thegoatspot.net
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
thesnhl.com thesnhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 136 days
FWHL FWHL-762769 Sep 2019 Oct 2019 35 days
AOL AOL-6614 Sep 2019 Sep 2019 One Off
top5.com top5.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
tpwhl.com tpwhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 87 days
FWHL FWHL-762737 May 2019 Aug 2019 74 days
AOL AOL-6614 Sep 2019 Oct 2019 34 days
udahl.com udahl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 87 days
FWHL FWHL-762769 Sep 2019 Oct 2019 33 days
FWHL FWHL-762737 Jul 2019 Aug 2019 26 days
birdsandblooms.com birdsandblooms.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
bizfluent.com bizfluent.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Sep 2019 142 days
ORC ORC-402 May 2019 Aug 2019 98 days
DM DM-100974 Jul 2019 Jul 2019 One Off
boredomtherapy.com boredomtherapy.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CU7QPX3O Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
browardpalmbeach.com browardpalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
ymcahc.ie ymcahc.ie
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
ORC ORC-402 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
consequenceofsound.net consequenceofsound.net
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 69 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
DM DM-100974 Jul 2019 Aug 2019 21 days
cowboylyrics.com cowboylyrics.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
creativeincomeblog.com creativeincomeblog.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
cuidatudinero.com cuidatudinero.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 49 days
SONO SONO-783272317B Jun 2019 Aug 2019 49 days
ORC ORC-402 Aug 2019 Aug 2019 One Off
customercarecontacts.com customercarecontacts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
davesgarden.com davesgarden.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
ORC ORC-402 Jul 2019 Jul 2019 One Off
decades.com decades.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
devilshockey.org devilshockey.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Aug 2019 Aug 2019 8 days
AOL AOL-6614 Jun 2019 Jun 2019 One Off
directexpose.com directexpose.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 69 days
FWHL FWHL-762737 May 2019 Jun 2019 41 days
NEX NEX-3391 Jun 2019 Jun 2019 One Off
electrek.co electrek.co
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 92 days
ORC ORC-402 May 2019 Aug 2019 92 days
SONO SONO-783272317B May 2019 Aug 2019 92 days
entertainmentforus.com entertainmentforus.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Jun 2019 Aug 2019 55 days
gfmha.ca gfmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
golf.co.uk golf.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 51 days
ORC ORC-402 Jun 2019 Aug 2019 51 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
gotceleb.com gotceleb.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
handitv.com handitv.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
helloaachen.com helloaachen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloamman.com helloamman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloarkansas.com helloarkansas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellobalchsprings.com hellobalchsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobattambang.com hellobattambang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobrainerd.com hellobrainerd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobrampton.com hellobrampton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobridgeport.com hellobridgeport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobucheon.com hellobucheon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobuckscounty.com hellobuckscounty.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocaledon.com hellocaledon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellocalifornia.com hellocalifornia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellochulavista.com hellochulavista.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocleveland.com hellocleveland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocolorado.com hellocolorado.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloconcord.com helloconcord.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocostamesa.com hellocostamesa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocraiova.com hellocraiova.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellocresthill.com hellocresthill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloculiacan.com helloculiacan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodaejeon.com hellodaejeon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodanyang.com hellodanyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodaqing.com hellodaqing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodecaturil.com hellodecaturil.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodortmund.com hellodortmund.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodudley.com hellodudley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloeagan.com helloeagan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Jul 2014 2 years, 133 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloeastridge.com helloeastridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloflorida.com helloflorida.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Dec 2020 2 years, 133 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloforestgrove.com helloforestgrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellofuqing.com hellofuqing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogallatin.com hellogallatin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellogardengrove.com hellogardengrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellogilber.com hellogilber.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
helloglencove.com helloglencove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellograndisland.com hellograndisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellograndrapids.com hellograndrapids.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellohamhung.com hellohamhung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohollysprings.com hellohollysprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloillinois.com helloillinois.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloisfahan.com helloisfahan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
helloisrael.com helloisrael.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokamloops.com hellokamloops.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokansas.com hellokansas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellolacoruna.com hellolacoruna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolauderhill.com hellolauderhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellolaval.com hellolaval.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolefkada.com hellolefkada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellolevis.com hellolevis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolianjiang.com hellolianjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolockport.com hellolockport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomadagascar.com hellomadagascar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomaine.com hellomaine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomannheim.com hellomannheim.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomilford.com hellomilford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellomineola.com hellomineola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomontebello.com hellomontebello.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomountpleasant.com hellomountpleasant.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellomudanjiang.com hellomudanjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonantes.com hellonantes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonashville.com hellonashville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellonebraska.com hellonebraska.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellonewbritain.com hellonewbritain.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 254 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellonewhampshire.com hellonewhampshire.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonewmexico.com hellonewmexico.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonewportbeach.com hellonewportbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonewportnews.com hellonewportnews.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloniamey.com helloniamey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonorthport.com hellonorthport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellonorthvancouver.com hellonorthvancouver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellooakland.com hellooakland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellooakville.com hellooakville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopascagoula.com hellopascagoula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellopickering.com hellopickering.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Nov 2020 Nov 2020 One Off
hellopleasantprairie.com hellopleasantprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopompanobeach.com hellopompanobeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopraia.com hellopraia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
helloqidong.com helloqidong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloreggiocalabria.com helloreggiocalabria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellorichmond.com hellorichmond.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellorosemead.com hellorosemead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellorostovondon.com hellorostovondon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellorowlett.com hellorowlett.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloruian.com helloruian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosaginaw.com hellosaginaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosaintcroix.com hellosaintcroix.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosaoluis.com hellosaoluis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosarnia.com hellosarnia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloscandinavia.com helloscandinavia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloseville.com helloseville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosherbrooke.com hellosherbrooke.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloshouguang.com helloshouguang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosinteustatius.com hellosinteustatius.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloskopelos.com helloskopelos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosolanabeach.com hellosolanabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosouthbend.com hellosouthbend.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosouthcarolina.com hellosouthcarolina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellostevenspoint.com hellostevenspoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosuwon.com hellosuwon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotemple.com hellotemple.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloterrebonne.com helloterrebonne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
helloterrell.com helloterrell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellotimisoara.com hellotimisoara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotogo.com hellotogo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotukwila.com hellotukwila.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellotver.com hellotver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloulaanbaatar.com helloulaanbaatar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellovaticancity.com hellovaticancity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellovermont.com hellovermont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellovillapark.com hellovillapark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloweinan.com helloweinan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowestvirginia.com hellowestvirginia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowiesbaden.com hellowiesbaden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowilkesbarre.com hellowilkesbarre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowilsonville.com hellowilsonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellowoodlandpark.com hellowoodlandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloxinyang.com helloxinyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
history101.com history101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 110 days
NEX NEX-3391 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
historyanswers.co.uk historyanswers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 68 days
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
DM DM-100974 Jul 2019 Aug 2019 20 days
hothardware.com hothardware.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Jul 2019 One Off
ibtimes.com ibtimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
ORC ORC-402 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
itproportal.com itproportal.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Aug 2019 21 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
luxandlush.com luxandlush.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 103 days
FWHL FWHL-762769 Aug 2019 Oct 2019 52 days
FWHL FWHL-762737 Jun 2019 Aug 2019 42 days
marlinmag.com marlinmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
missouriwhitetails.com missouriwhitetails.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
mmajunkie.com mmajunkie.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
ORC ORC-402 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
ninjabeat.com ninjabeat.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 146 days
DM DM-100974 May 2019 Aug 2019 85 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
readfootball.co readfootball.co
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readgolf.com readgolf.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
readhull.com readhull.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 Jul 2019 Aug 2019 33 days
readtennis.co readtennis.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
pcrmra.ca pcrmra.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 97 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
phoenixnewtimes.com phoenixnewtimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
registercitizen.com registercitizen.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
readbournemouth.com readbournemouth.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
readchampionship.com readchampionship.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
airdrieunited-mad.co.uk airdrieunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 65 days
DM DM-100974 Jun 2019 Aug 2019 65 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
armytimes.com armytimes.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jul 2019 48 days
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
allaccess.com allaccess.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
antonym.com antonym.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
DM DM-100974 Jun 2019 Jul 2019 48 days
ORC ORC-402 Jun 2019 Jun 2019 One Off
sportfishingmag.com sportfishingmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
abc57.com abc57.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
svengoolie.com svengoolie.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
techlicious.com techlicious.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
ORC ORC-402 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
theawesomer.com theawesomer.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
azlyrics.com azlyrics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
NEX NEX-3391 Jul 2019 Aug 2019 21 days
readwestbrom.com readwestbrom.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Aug 2019 52 days
DM DM-100974 Jul 2019 Aug 2019 33 days
ORC ORC-402 Jul 2019 Aug 2019 33 days
becauseofthemwecan.com becauseofthemwecan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 26 days
trails.com trails.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
ORC ORC-402 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
trueself.com trueself.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 74 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
bhaskar.com bhaskar.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
bjpenn.com bjpenn.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
ORC ORC-402 Jun 2019 Jun 2019 One Off
bmgmediasolutions.com bmgmediasolutions.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 159 days
FWHL FWHL-762737 Jun 2019 Aug 2019 62 days
DM DM-100974 Jul 2019 Jul 2019 One Off
boxofficeindia.com boxofficeindia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
wonderwall.com wonderwall.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
ORC ORC-402 Jun 2019 Jul 2019 48 days
zksrilanka.com zksrilanka.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
cinemablend.com cinemablend.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
citiblog.co.uk citiblog.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 49 days
ORC ORC-402 Jun 2019 Jul 2019 49 days
SONO SONO-783272317B Jun 2019 Jul 2019 49 days
familyevents.com familyevents.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
dunfermlineathletic-mad.co.uk dunfermlineathletic-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 56 days
ORC ORC-402 Jun 2019 Aug 2019 56 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
ehowenespanol.com ehowenespanol.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Jun 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
favesouthernrecipes.com favesouthernrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
followfollow.com followfollow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
footballfancast.com footballfancast.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
AOL AOL-6748 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
helloaguascalientes.com helloaguascalientes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloalamogordo.com helloalamogordo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloalbany.com helloalbany.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloanyang.com helloanyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloasmara.com helloasmara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloasuncion.com helloasuncion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloaustin.com helloaustin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobandarlampung.com hellobandarlampung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobatavia.com hellobatavia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobensenville.com hellobensenville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobessemer.com hellobessemer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobowie.com hellobowie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobuenapark.com hellobuenapark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocedarhill.com hellocedarhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellochamplin.com hellochamplin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellochangde.com hellochangde.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellochillicothe.com hellochillicothe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloclarington.com helloclarington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellococoabeach.com hellococoabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocollegepark.com hellocollegepark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-350746 Oct 2013 Oct 2013 One Off
hellocottagegrove.com hellocottagegrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocudahy.com hellocudahy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocupertino.com hellocupertino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellodatong.com hellodatong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodel.com hellodel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellodelaware.com hellodelaware.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloeastbethel.com helloeastbethel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloelmirage.com helloelmirage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloelpaso.com helloelpaso.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloencinitas.com helloencinitas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Sep 2018 Sep 2018 One Off
hellofes.com hellofes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogalati.com hellogalati.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogoiania.com hellogoiania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogoyang.com hellogoyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloguadeloupe.com helloguadeloupe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloguangyuan.com helloguangyuan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloguiping.com helloguiping.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohaiphong.com hellohaiphong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohandan.com hellohandan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohaora.com hellohaora.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohengyang.com hellohengyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohiltonhead.com hellohiltonhead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloholladay.com helloholladay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellohuntingtonbeach.com hellohuntingtonbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloindiana.com helloindiana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloindianola.com helloindianola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloindiantrail.com helloindiantrail.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Oct 2013 Oct 2013 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellojalgaon.com hellojalgaon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojianyang.com hellojianyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojining.com hellojining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokhulna.com hellokhulna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloliege.com helloliege.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolincolnpark.com hellolincolnpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloliuyang.com helloliuyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolouisiana.com hellolouisiana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloluoyang.com helloluoyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomapleridge.com hellomapleridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomarseilles.com hellomarseilles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomessina.com hellomessina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomianyang.com hellomianyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomikonos.com hellomikonos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonanan.com hellonanan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonanyang.com hellonanyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloneworleans.com helloneworleans.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellonewwestminster.com hellonewwestminster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonizhnynovgorod.com hellonizhnynovgorod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonorthdakota.com hellonorthdakota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellonorthlasvegas.com hellonorthlasvegas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloogden.com helloogden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellooman.com hellooman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
helloonalaska.com helloonalaska.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloostrava.com helloostrava.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellooswego.com hellooswego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 May 2014 2 years, 77 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellopalmdesert.com hellopalmdesert.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellopennsylvania.com hellopennsylvania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopetaluma.com hellopetaluma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopittsburg.com hellopittsburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellopoway.com hellopoway.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopoznan.com hellopoznan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopretoria.com hellopretoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloqianjiang.com helloqianjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloranchocucamonga.com helloranchocucamonga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloreims.com helloreims.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellorennes.com hellorennes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellorolla.com hellorolla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloryazan.com helloryazan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosaintetienne.com hellosaintetienne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosaintmaarten.com hellosaintmaarten.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosamara.com hellosamara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosangabriel.com hellosangabriel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosartell.com hellosartell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosedalia.com hellosedalia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloslidell.com helloslidell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Jan 2014 1 year, 317 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosoledad.com hellosoledad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosouthdakota.com hellosouthdakota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellospringhill.com hellospringhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosuining.com hellosuining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotaishan.com hellotaishan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloteresina.com helloteresina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotexasusa.com hellotexasusa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotianmen.com hellotianmen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotrenton.com hellotrenton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellotshwane.com hellotshwane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotyumen.com hellotyumen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
hellounionca.com hellounionca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellovirginiausa.com hellovirginiausa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloweifang.com helloweifang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowestmont.com hellowestmont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellowhitefishbay.com hellowhitefishbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloxining.com helloxining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellozakynthos.com hellozakynthos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellozhanjiang.com hellozhanjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
justmommies.com justmommies.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Jul 2019 48 days
laraza.com laraza.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jul 2019 Jul 2019 One Off
latintimes.com latintimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
mrfood.com mrfood.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
obsev.com obsev.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 145 days
ORC ORC-402 May 2019 Jul 2019 47 days
SONO SONO-783272317B May 2019 May 2019 One Off
orlandoweekly.com orlandoweekly.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Sep 2019 104 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
AOL AOL-6748 Jul 2019 Sep 2019 56 days
pointstreak.com pointstreak.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Oct 2019 26 days
AOL AOL-6614 Sep 2019 Oct 2019 26 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
portageminorhockey.com portageminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 82 days
AOL AOL-6614 May 2019 Jul 2019 47 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
riverfronttimes.com riverfronttimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 130 days
AOL AOL-6748 Jul 2019 Oct 2019 82 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
rugby.co.uk rugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Aug 2019 32 days
DM DM-100974 Jul 2019 Aug 2019 32 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
sackvilleminorhockey.ca sackvilleminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 93 days
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
sacurrent.com sacurrent.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 82 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
AOL AOL-6614 Jun 2019 Jul 2019 48 days
scribol.com scribol.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
airlinepilotcentral.com airlinepilotcentral.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
articlebio.com articlebio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
sleafordcc.co.uk sleafordcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
ORC ORC-402 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
splitcoaststampers.com splitcoaststampers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
sportsmedia101.com sportsmedia101.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 90 days
FWHL FWHL-762769 Sep 2019 Oct 2019 38 days
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
sunset.com sunset.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
allfreekidscrafts.com allfreekidscrafts.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
technabob.com technabob.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
ORC ORC-402 Jun 2019 Jun 2019 One Off
vectisrugby.co.uk vectisrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
blackburnrovers-mad.co.uk blackburnrovers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 13 days
ORC ORC-402 Jul 2019 Aug 2019 13 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
blogher.com blogher.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
weddingbee.com weddingbee.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
westword.com westword.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
broadwayworld.com broadwayworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jul 2019 Aug 2019 21 days
celebmafia.com celebmafia.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Jun 2019 Jun 2019 One Off
celebsugar.com celebsugar.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
chron.com chron.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
cnwhc.co.uk cnwhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
cvba.ca cvba.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 119 days
FWHL FWHL-762769 Jun 2019 Oct 2019 119 days
AOL AOL-6614 Sep 2019 Sep 2019 One Off
cyclingnews.com cyclingnews.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
defensenews.com defensenews.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
dundeeunited-mad.co.uk dundeeunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 56 days
DM DM-100974 Aug 2019 Aug 2019 7 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
equestriadaily.com equestriadaily.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
ORC ORC-402 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
esportslatest.com esportslatest.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 49 days
ORC ORC-402 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
ggha.ca ggha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 Jun 2019 Oct 2019 109 days
AOL AOL-6614 Oct 2019 Oct 2019 One Off
gizmodo.co.uk gizmodo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 98 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
guyandtheblog.com guyandtheblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 1 day
ORC ORC-402 Aug 2019 Aug 2019 1 day
AOL AOL-49648 Aug 2019 Aug 2019 One Off
haslemererugby.co.uk haslemererugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
helloacworth.com helloacworth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloahwaz.com helloahwaz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2018 Jan 2021 2 years, 68 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloalgonquin.com helloalgonquin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloamorgos.com helloamorgos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloansonia.com helloansonia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloartesia.com helloartesia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloaurora.com helloaurora.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloavondale.com helloavondale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobahamas.com hellobahamas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobayonne.com hellobayonne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobelgorod.com hellobelgorod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobujumbura.com hellobujumbura.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellocarmel.com hellocarmel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellochapelhill.com hellochapelhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellochowchilla.com hellochowchilla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocolombia.com hellocolombia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocoralgables.com hellocoralgables.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-350746 Oct 2013 Oct 2013 One Off
hellodallas.com hellodallas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellodenver.com hellodenver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellodoral.com hellodoral.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloeastpeoria.com helloeastpeoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellofalklandislands.com hellofalklandislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogardena.com hellogardena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellogongzhuling.com hellogongzhuling.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloguigang.com helloguigang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohagen.com hellohagen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohanahan.com hellohanahan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellohechuan.com hellohechuan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohims.com hellohims.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jan 2022 187 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohopkinsville.com hellohopkinsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellohuainan.com hellohuainan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojacksonvillebeach.com hellojacksonvillebeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellojinjiang.com hellojinjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokaohsiung.com hellokaohsiung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokent.com hellokent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokingman.com hellokingman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellolavergne.com hellolavergne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellolawrenceville.com hellolawrenceville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloleesburg.com helloleesburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloleicester.com helloleicester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolibreville.com hellolibreville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellologansport.com hellologansport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellolublin.com hellolublin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloludhiana.com helloludhiana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomariupol.com hellomariupol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomichigan.com hellomichigan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomombasa.com hellomombasa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomoncton.com hellomoncton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomonrovia.com hellomonrovia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellomontereypark.com hellomontereypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomontserrat.com hellomontserrat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomysore.com hellomysore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloneijiang.com helloneijiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonewbedford.com hellonewbedford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonewburyport.com hellonewburyport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellonewjersey.com hellonewjersey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonewyork.com hellonewyork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonorthmyrtlebeach.com hellonorthmyrtlebeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
helloocala.com helloocala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellooceansprings.com hellooceansprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellopacificbeach.com hellopacificbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopadova.com hellopadova.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopalmbay.com hellopalmbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopalmsprings.com hellopalmsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloparamount.com helloparamount.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellopawtucket.com hellopawtucket.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellopeekskill.com hellopeekskill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellopensacola.com hellopensacola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellopristina.com hellopristina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloredwood.com helloredwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellorichmondhill.com hellorichmondhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Jul 2020 Jan 2021 188 days
GTM GTM-UA-118129358-1 Jul 2020 Jan 2021 188 days
hellorochester.com hellorochester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellorockhill.com hellorockhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellorockvillecentre.com hellorockvillecentre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosaintnevis.com hellosaintnevis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosaintvincent.com hellosaintvincent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosamarkand.com hellosamarkand.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosandwell.com hellosandwell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosanjose.com hellosanjose.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosanrafael.com hellosanrafael.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosantafesprings.com hellosantafesprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosearcy.com hellosearcy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloshreveport.com helloshreveport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosolapur.com hellosolapur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosouthgate.com hellosouthgate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosrinagar.com hellosrinagar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellostatecollege.com hellostatecollege.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellotaichung.com hellotaichung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotangier.com hellotangier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotennessee.com hellotennessee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellothane.com hellothane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotorreon.com hellotorreon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotroisrivieres.com hellotroisrivieres.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Jul 2022 315 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloulsan.com helloulsan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellouniversal.com hellouniversal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellowadsworth.com hellowadsworth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellowesthaven.com hellowesthaven.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellowhitehall.com hellowhitehall.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellowuppertal.com hellowuppertal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloxingyang.com helloxingyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloyarmouth.com helloyarmouth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloyiyang.com helloyiyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloyonkers.com helloyonkers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hipointfirearmsforums.com hipointfirearmsforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
howtoadult.com howtoadult.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 98 days
DM DM-100974 Jun 2019 Aug 2019 49 days
ORC ORC-402 May 2019 May 2019 One Off
imore.com imore.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jul 2019 48 days
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
islands.com islands.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
DM DM-100974 Jun 2019 Jun 2019 One Off
kanatabasketball.ca kanatabasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 106 days
FWHL FWHL-762737 Jun 2019 Aug 2019 45 days
FWHL FWHL-762769 May 2019 May 2019 One Off
kaorinusantara.or.id kaorinusantara.or.id
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Jun 2019 48 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
laopinion.com laopinion.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
manchestercity-mad.co.uk manchestercity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 41 days
ORC ORC-402 Jun 2019 Aug 2019 41 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
maplesofthawks.com maplesofthawks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 102 days
AOL AOL-6614 Aug 2019 Oct 2019 51 days
FWHL FWHL-762737 May 2019 May 2019 One Off
metrotimes.com metrotimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 130 days
AOL AOL-6748 Jun 2019 Oct 2019 130 days
NEX NEX-3391 Jul 2019 Aug 2019 21 days
mynation.com mynation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
FWHL FWHL-762737 May 2019 May 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
newstimes.com newstimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
oola.com oola.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
oswh.ca oswh.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 97 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
pnwriders.com pnwriders.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 143 days
ORC ORC-402 May 2019 Aug 2019 82 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
readcricket.com readcricket.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readmanutd.com readmanutd.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
roughmaps.com roughmaps.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 93 days
DM DM-100974 May 2019 Aug 2019 79 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
scroll.in scroll.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
scunthorpeunited-mad.co.uk scunthorpeunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 31 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
sfmha.ca sfmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 92 days
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
shoppinglifestyle.com shoppinglifestyle.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
spaceanswers.com spaceanswers.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
sportdiver.com sportdiver.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
sportskeeda.com sportskeeda.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
stourbridgefc.com stourbridgefc.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 47 days
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
ORC ORC-402 Jul 2019 Jul 2019 One Off
stwalburghockey.com stwalburghockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Oct 2019 37 days
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
superstreetbike.com superstreetbike.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ORC ORC-402 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
svconline.com svconline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
ORC ORC-402 Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
allfreecrochet.com allfreecrochet.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
techradar.com techradar.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
timesofoman.com timesofoman.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
toptenz.net toptenz.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
ultrasurfing.com ultrasurfing.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
uppercanadacyclones.com uppercanadacyclones.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 73 days
AOL AOL-6614 Sep 2019 Oct 2019 33 days
FWHL FWHL-762769 Sep 2019 Oct 2019 33 days
canveyislandfc.com canveyislandfc.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
carolinahuddle.com carolinahuddle.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
yourdictionary.com yourdictionary.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
ORC ORC-402 Jun 2019 Jun 2019 One Off
cbs58.com cbs58.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
cdmha.ca cdmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
corshamcc.co.uk corshamcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jul 2019 49 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 39 days
DM DM-100974 Jun 2019 Jun 2019 One Off
creativebloq.com creativebloq.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
deccanherald.com deccanherald.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 119 days
FWHL FWHL-762737 Jun 2019 Aug 2019 58 days
IEX IEX-189205 Sep 2019 Oct 2019 11 days
dirtrider.com dirtrider.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
doverathletic-mad.co.uk doverathletic-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 7 days
ORC ORC-402 Aug 2019 Aug 2019 7 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
dronedj.com dronedj.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 91 days
ORC ORC-402 May 2019 Aug 2019 91 days
SONO SONO-783272317B May 2019 Aug 2019 91 days
femalehockeychallenge.com femalehockeychallenge.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
folkestonerugbyclub.co.uk folkestonerugbyclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Aug 2019 50 days
SONO SONO-783272317B May 2019 Jun 2019 45 days
ORC ORC-402 Aug 2019 Aug 2019 One Off
fountainof30.com fountainof30.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 3 days
ORC ORC-402 Aug 2019 Aug 2019 3 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
georgiapacking.org georgiapacking.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
glockforum.com glockforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
goneoutdoors.com goneoutdoors.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 97 days
ORC ORC-402 May 2019 Aug 2019 97 days
DM DM-100974 Jun 2019 Jun 2019 One Off
happybeinghealthy.com happybeinghealthy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
helloalameda.com helloalameda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloanegada.com helloanegada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloanshan.com helloanshan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloastrakhan.com helloastrakhan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloaventura.com helloaventura.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobazhong.com hellobazhong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobenicia.com hellobenicia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobolton.com hellobolton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobrighton.com hellobrighton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
helloburlingame.com helloburlingame.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocoloradospings.com hellocoloradospings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellocrowley.com hellocrowley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocrownpoint.com hellocrownpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellodaytona.com hellodaytona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellodebrecen.com hellodebrecen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodeserthotsprings.com hellodeserthotsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellodesmoines.com hellodesmoines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellodestin.com hellodestin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellodnipro.com hellodnipro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodominicanrepublic.com hellodominicanrepublic.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodoncaster.com hellodoncaster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodouglas.com hellodouglas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellodrummondville.com hellodrummondville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloegypt.com helloegypt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloelgin.com helloelgin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloeunice.com helloeunice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloeureka.com helloeureka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellofortcollins.com hellofortcollins.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellofortmyers.com hellofortmyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellofrankfort.com hellofrankfort.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellogaithersburg.com hellogaithersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogarland.com hellogarland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellogdynia.com hellogdynia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogelsenkirchen.com hellogelsenkirchen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogeorgia.com hellogeorgia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellogijon.com hellogijon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogreenwich.com hellogreenwich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellohaicheng.com hellohaicheng.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohaimen.com hellohaimen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohannover.com hellohannover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohopewell.com hellohopewell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-350746 Oct 2013 Oct 2013 One Off
hellohurricane.com hellohurricane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellojabalpur.com hellojabalpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojamshedpur.com hellojamshedpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojessore.com hellojessore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojordan.com hellojordan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellojuba.com hellojuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokaifeng.com hellokaifeng.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokawarthalakes.com hellokawarthalakes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokazan.com hellokazan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokurgan.com hellokurgan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolakeland.com hellolakeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellolawrence.com hellolawrence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellolebanon.com hellolebanon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolufeng.com hellolufeng.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomassachusetts.com hellomassachusetts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellomesa.com hellomesa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellomidland.com hellomidland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellominnesota.com hellominnesota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellomontanausa.com hellomontanausa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomultan.com hellomultan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomurrieta.com hellomurrieta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonaucalpan.com hellonaucalpan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonevada.com hellonevada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellonorthcarolina.com hellonorthcarolina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
helloohio.com helloohio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellooviedo.com hellooviedo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellopalatine.com hellopalatine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellopaloalto.com hellopaloalto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloparma.com helloparma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellopassaic.com hellopassaic.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopflugerville.com hellopflugerville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
hellopingdingshan.com hellopingdingshan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloportland.com helloportland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloprincegeorge.com helloprincegeorge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellorosemount.com hellorosemount.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosaintjerome.com hellosaintjerome.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaintmartin.com hellosaintmartin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosandiego.com hellosandiego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosanibelisland.com hellosanibelisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosaultstemarie.com hellosaultstemarie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellosausalito.com hellosausalito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosebastian.com hellosebastian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosheboygan.com hellosheboygan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloshelbyville.com helloshelbyville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosherman.com hellosherman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloshijiazhuang.com helloshijiazhuang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloskiathos.com helloskiathos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellostcatharines.com hellostcatharines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
hellostudiocity.com hellostudiocity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellosugarland.com hellosugarland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloszczecin.com helloszczecin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotashkent.com hellotashkent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellothehague.com hellothehague.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
hellotrieste.com hellotrieste.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotualatin.com hellotualatin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloturkscaicos.com helloturkscaicos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018 38 days
hellotwentyninepalms.com hellotwentyninepalms.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellovadodara.com hellovadodara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowafangdian.com hellowafangdian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowoodland.com hellowoodland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
hellowujiang.com hellowujiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellozaporizhia.com hellozaporizhia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
irlamvale.co.uk irlamvale.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
ORC ORC-402 Jun 2019 Jun 2019 One Off
kmmohockey.org kmmohockey.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
lovetoknow.com lovetoknow.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
lyricsondemand.com lyricsondemand.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
mirchi9.com mirchi9.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 148 days
FWHL FWHL-762737 May 2019 Aug 2019 87 days
FWHL FWHL-762769 Aug 2019 Oct 2019 50 days
musicradar.com musicradar.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 69 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
oabo.ca oabo.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
AOL AOL-6614 Jul 2019 Jul 2019 One Off
okz.ca okz.ca
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 145 days
FWHL FWHL-762737 May 2019 Aug 2019 84 days
FWHL FWHL-762769 Aug 2019 Oct 2019 47 days
ourmidland.com ourmidland.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
penguinmd.com penguinmd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 83 days
FWHL FWHL-762769 Aug 2019 Oct 2019 45 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 45 days
prepbaseballreport.com prepbaseballreport.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Jul 2019 One Off
radioworld.com radioworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jul 2019 Aug 2019 21 days
readbasketball.com readbasketball.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 80 days
ORC ORC-402 May 2019 Aug 2019 80 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readfilm.co readfilm.co
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 80 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
ORC ORC-402 Jul 2019 Aug 2019 33 days
realitypod.com realitypod.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
actoniansrfc.com actoniansrfc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
rumbunter.com rumbunter.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
rushthecourt.net rushthecourt.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
santabanta.com santabanta.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Oct 2019 26 days
AOL AOL-6748 Sep 2019 Oct 2019 26 days
archauthority.com archauthority.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
sbobrfc.co.uk sbobrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
sci-techmaven.io sci-techmaven.io
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
science101.com science101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 47 days
NEX NEX-3391 Jul 2019 Aug 2019 31 days
sdfpl.co.uk sdfpl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
ahoramismo.com ahoramismo.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 Aug 2019 98 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
ardsrugby.co.uk ardsrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 49 days
SONO SONO-783272317B May 2019 Jun 2019 34 days
secondnexus.com secondnexus.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 47 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
aiyinsitanblog.ml aiyinsitanblog.ml
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
sgvtribune.com sgvtribune.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
allfreecopycatrecipes.com allfreecopycatrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
allfreeholidaycrafts.com allfreeholidaycrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
showt.com showt.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 139 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 139 days
allucanheat.com allucanheat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
armchairgeneral.com armchairgeneral.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
skmov.com skmov.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Oct 2019 39 days
IEX IEX-189205 Sep 2019 Oct 2019 39 days
skywayshoutout.com skywayshoutout.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
animalchannel.co animalchannel.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
DM DM-100974 Jun 2019 Jun 2019 One Off
somha.ca somha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Sep 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
apnamudda.com apnamudda.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 20 days
PUBM PUBM-158017 Sep 2019 Oct 2019 20 days
soy502.com soy502.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 38 days
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
soycarmin.com soycarmin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 138 days
FWHL FWHL-762737 May 2019 Aug 2019 77 days
spartanavenue.com spartanavenue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
sport.co.uk sport.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 21 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
srsoccerleague.ca srsoccerleague.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 137 days
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
strettynews.com strettynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
stripehype.com stripehype.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
abaceltics.ca abaceltics.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-6748 Jul 2019 Jul 2019 One Off
survivinginfidelity.com survivinginfidelity.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
anganwadirecruitment.in anganwadirecruitment.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 16 days
atraccion360.com atraccion360.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Jul 2019 Aug 2019 15 days
telemundowi.com telemundowi.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 75 days
ORC ORC-402 May 2019 Aug 2019 75 days
thaivisa.com thaivisa.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
cardiffcity-mad.co.uk cardiffcity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 60 days
DM DM-100974 Jun 2019 Aug 2019 60 days
awinninghabit.com awinninghabit.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thecanuckway.com thecanuckway.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
theglhl.com theglhl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 27 days
AOL AOL-6748 May 2019 May 2019 One Off
azchords.com azchords.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Jul 2019 Jul 2019 One Off
theedd.ca theedd.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 88 days
FWHL FWHL-762737 May 2019 Aug 2019 75 days
thehindu.com thehindu.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 26 days
thelandryhat.com thelandryhat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
bachpan.com bachpan.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 18 days
PUBM PUBM-158017 Sep 2019 Oct 2019 18 days
themobileindian.com themobileindian.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
thepoliticalinsider.com thepoliticalinsider.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
thestokesnews.com thestokesnews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Oct 2019 26 days
AOL AOL-6614 Sep 2019 Oct 2019 26 days
thongsbridgecricketclub.co.uk thongsbridgecricketclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
bamsmackpow.com bamsmackpow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
threebridgesfc.co.uk threebridgesfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
tikout.com tikout.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
timesherald.com timesherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
tollypics.com tollypics.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
tolucalabellacd.com tolucalabellacd.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
bermudatriplecrown.com bermudatriplecrown.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
beyondtheflag.com beyondtheflag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
uintacountyherald.com uintacountyherald.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 82 days
AOL AOL-6748 Jun 2019 Jun 2019 One Off
ukulele-chords.com ukulele-chords.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 134 days
NEX NEX-3391 May 2019 Aug 2019 73 days
bia2.tv bia2.tv
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
uniondailytimes.com uniondailytimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 130 days
AOL AOL-6748 Sep 2019 Sep 2019 One Off
bitrixc.info bitrixc.info
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
veblr.com veblr.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
vegashockeyknight.com vegashockeyknight.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 73 days
FWHL FWHL-762769 Sep 2019 Oct 2019 32 days
bobcatattack.com bobcatattack.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
boilingwithbias.com boilingwithbias.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 85 days
FWHL FWHL-762737 Jul 2019 Aug 2019 13 days
boltonwanderers-mad.co.uk boltonwanderers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Aug 2019 13 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
wbir.com wbir.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
wcoanimedub.tv wcoanimedub.tv
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 31 days
PUBM PUBM-158017 Sep 2019 Oct 2019 31 days
wcoanimesub.tv wcoanimesub.tv
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 31 days
PUBM PUBM-158017 Sep 2019 Oct 2019 31 days
wcoastswing.com wcoastswing.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
AOL AOL-6614 Sep 2019 Sep 2019 One Off
wildcatbluenation.com wildcatbluenation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
bsmf.ca bsmf.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 73 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
wimp.com wimp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
wittyfeed.tv wittyfeed.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
wjbq.com wjbq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
buffalowdown.com buffalowdown.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
wkyc.com wkyc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
burlington-record.com burlington-record.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
worldofsolitaire.com worldofsolitaire.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
worldwideinterweb.com worldwideinterweb.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 130 days
AOL AOL-6614 Jul 2019 Jul 2019 One Off
writingillini.com writingillini.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
cafecrime.com cafecrime.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 Aug 2019 98 days
DM DM-100974 Jul 2019 Jul 2019 One Off
yabo0990.com yabo0990.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
yallalive.tv yallalive.tv
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
youlike89.com youlike89.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
ccjhl.net ccjhl.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
ccmb.co.uk ccmb.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 60 days
ORC ORC-402 Jul 2019 Aug 2019 11 days
zoffar.com zoffar.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
cltampa.com cltampa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 82 days
AOL AOL-6614 Sep 2019 Oct 2019 26 days
coloradodaily.com coloradodaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
curiosity.com curiosity.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
dailycamera.com dailycamera.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
dailyknicks.com dailyknicks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 70 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
dairylandexpress.com dairylandexpress.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
designyourway.net designyourway.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
dimensionsmagazine.com dimensionsmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 69 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
doramatv.live doramatv.live
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
draftthreads.com draftthreads.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jun 2019 42 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 42 days
dynamitenews.com dynamitenews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 8 days
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 8 days
ebonybird.com ebonybird.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
ebook3000.biz ebook3000.biz
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 8 days
PUBM PUBM-158017 Oct 2019 Oct 2019 8 days
eclecticesoterica.com eclecticesoterica.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
egotastic.com egotastic.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
eldiariony.com eldiariony.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
eleconomistaamerica.com eleconomistaamerica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Aug 2019 Oct 2019 67 days
eleconomistaamerica.pe eleconomistaamerica.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Aug 2019 Oct 2019 67 days
eluniversal.com.co eluniversal.com.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
empireofthekop.com empireofthekop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Jun 2019 Aug 2019 55 days
esakal.com esakal.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
expreso.ec expreso.ec
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 153 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
ezwatercalculator.com ezwatercalculator.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 65 days
DM DM-100974 Aug 2019 Aug 2019 4 days
francetabs.com francetabs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 53 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
frozenfutures.com frozenfutures.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
fulltvshows.org fulltvshows.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
gardenguides.com gardenguides.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
gbcmag.com gbcmag.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 2 days
ORC ORC-402 Aug 2019 Aug 2019 2 days
gcmha.com gcmha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-6748 Aug 2019 Oct 2019 63 days
gearbrain.com gearbrain.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 96 days
SONO SONO-783272317B May 2019 Aug 2019 96 days
ggpan.com ggpan.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
ginadwagner.com ginadwagner.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 2 days
ORC ORC-402 Aug 2019 Aug 2019 2 days
glamsham.com glamsham.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
greenwichtime.com greenwichtime.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
gtaall.net gtaall.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
gtavicecity.ru gtavicecity.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
gujaratimidday.com gujaratimidday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 62 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
hagomitarea.com hagomitarea.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 May 2019 One Off
hamiltonacademical-mad.co.uk hamiltonacademical-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
helloalhambra.com helloalhambra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloalton.com helloalton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloanguilla.com helloanguilla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
helloanniston.com helloanniston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Mar 2014 2 years, 14 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobangor.com hellobangor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobeaverton.com hellobeaverton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobelton.com hellobelton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloburton.com helloburton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellocenterville.com hellocenterville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellocerritos.com hellocerritos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloclarksdale.com helloclarksdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-350746 Oct 2013 Oct 2013 One Off
hellocollinsville.com hellocollinsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-350746 Oct 2013 Oct 2013 One Off
hellocompton.com hellocompton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-350746 Oct 2013 Oct 2013 One Off
hellodecatur.com hellodecatur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Mar 2020 Jan 2021 298 days
hellodecatural.com hellodecatural.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellodelmar.com hellodelmar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellodesplaines.com hellodesplaines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloelcentro.com helloelcentro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloelmira.com helloelmira.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloencino.com helloencino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloevans.com helloevans.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellofridley.com hellofridley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogarner.com hellogarner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellografton.com hellografton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellograndville.com hellograndville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellogranite.com hellogranite.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogreer.com hellogreer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohaverhill.com hellohaverhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellohazelwood.com hellohazelwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellohazleton.com hellohazleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohempsteadvillage.com hellohempsteadvillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellohendersonville.com hellohendersonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohoover.com hellohoover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellojackson.com hellojackson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellojapan.com hellojapan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellojonesboro.com hellojonesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokaysville.com hellokaysville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokearney.com hellokearney.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolakecharles.com hellolakecharles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloleague.com helloleague.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Feb 2020 Jan 2021 333 days
hellolexington.com hellolexington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolosgatos.com hellolosgatos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomadison.com hellomadison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomaryland.com hellomaryland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellomcalester.com hellomcalester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomokena.com hellomokena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomustang.com hellomustang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomykonos.com hellomykonos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellonorthadams.com hellonorthadams.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorthlauderdale.com hellonorthlauderdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopearland.com hellopearland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopendleton.com hellopendleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellopickerington.com hellopickerington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopoquoson.com hellopoquoson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloqueens.com helloqueens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloramsey.com helloramsey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorobbinsdale.com hellorobbinsdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorockledge.com hellorockledge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloroselle.com helloroselle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosachse.com hellosachse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosanger.com hellosanger.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloscranton.com helloscranton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosherwood.com hellosherwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellosnellville.com hellosnellville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosolon.com hellosolon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosouthholland.com hellosouthholland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellostillwater.com hellostillwater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellostpeters.com hellostpeters.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosudbury.com hellosudbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotallmadge.com hellotallmadge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellothornton.com hellothornton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotifton.com hellotifton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotooele.com hellotooele.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotortola.com hellotortola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellovirgingorda.com hellovirgingorda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellovirginislands.com hellovirginislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
hellowaltham.com hellowaltham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellowestspringfield.com hellowestspringfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowilmington.com hellowilmington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowoodbury.com hellowoodbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2014 2 years, 77 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloworthington.com helloworthington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hhringette.ca hhringette.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
hiddenremote.com hiddenremote.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
hoy.com.do hoy.com.do
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 97 days
FWHL FWHL-762769 Aug 2019 Oct 2019 60 days
hoyosrevenge.com hoyosrevenge.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 49 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
idcmha.ca idcmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 157 days
FWHL FWHL-762769 Jun 2019 Oct 2019 109 days
indiaparenting.com indiaparenting.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
inkonindy.com inkonindy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
insideibrox.com insideibrox.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 156 days
FWHL FWHL-762737 Jun 2019 Aug 2019 47 days
jpost.com jpost.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 154 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
kgha.ca kgha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 106 days
AOL AOL-6748 Jun 2019 Aug 2019 51 days
kingsofkauffman.com kingsofkauffman.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
kltigersrfc.com kltigersrfc.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
koimoi.com koimoi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
kumudam.com kumudam.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 54 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 54 days
raisingzona.com raisingzona.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
lametropolesports.com lametropolesports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Jul 2019 49 days
lanacion.com.ar lanacion.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 43 days
FWHL FWHL-762769 May 2019 May 2019 One Off
lastwordonsports.com lastwordonsports.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
leasticoulddo.com leasticoulddo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 81 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
leytonorient-mad.co.uk leytonorient-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 43 days
ORC ORC-402 Jun 2019 Aug 2019 43 days
miaminewtimes.com miaminewtimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
lifebru.com lifebru.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
lombardiave.com lombardiave.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
lwos.life lwos.life
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
lwosports.com lwosports.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 52 days
IEX IEX-189205 Aug 2019 Oct 2019 52 days
lyricsmania.com lyricsmania.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
mdzol.com mdzol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
mendotareporter.com mendotareporter.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 130 days
AOL AOL-6614 Jul 2019 Oct 2019 82 days
mercurynews.com mercurynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
michigansthumb.com michigansthumb.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
motorcitybengals.com motorcitybengals.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
mpsctoday.com mpsctoday.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
mtgsideboard.com mtgsideboard.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 39 days
FWHL FWHL-762769 May 2019 May 2019 One Off
nertazw.com nertazw.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
netflixlife.com netflixlife.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
newcastleunited-mad.co.uk newcastleunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 38 days
ORC ORC-402 Jul 2019 Aug 2019 38 days
newsbugz.com newsbugz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 48 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 48 days
nflmocks.com nflmocks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
ramblinfan.com ramblinfan.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
nhknightshockey.com nhknightshockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 47 days
AOL AOL-6748 Jul 2019 Jul 2019 One Off
nigeriaworld.com nigeriaworld.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
nipawinmha.ca nipawinmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 146 days
AOL AOL-6748 May 2019 May 2019 One Off
nocartridge.com nocartridge.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 38 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
range365.com range365.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 94 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
northbankrsl.com northbankrsl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 38 days
FWHL FWHL-762769 May 2019 May 2019 One Off
novelcool.com novelcool.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 47 days
IEX IEX-189205 Aug 2019 Oct 2019 47 days
nugglove.com nugglove.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
obozrevatel.com obozrevatel.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
odishatv.in odishatv.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 47 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 47 days
oomph.co.id oomph.co.id
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
openlist.com openlist.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 26 days
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
orangeintheoven.com orangeintheoven.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
otowns11.com otowns11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
ottawalittlesens.com ottawalittlesens.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
parolesmania.com parolesmania.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
readberserk.com readberserk.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
readbundesliga.com readbundesliga.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
readchelsea.com readchelsea.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
readshowbiz.co readshowbiz.co
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 80 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readstoke.com readstoke.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 47 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
phpclasses.hu phpclasses.hu
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 45 days
PUBM PUBM-158017 Aug 2019 Oct 2019 45 days
picbear.org picbear.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Aug 2019 16 days
pikstagram.net pikstagram.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
pottsmerc.com pottsmerc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
pricepanda.com.my pricepanda.com.my
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 82 days
ORC ORC-402 May 2019 Aug 2019 82 days
proceso.com.mx proceso.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 95 days
FWHL FWHL-762737 May 2019 Aug 2019 81 days
puckettspond.com puckettspond.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
punchng.com punchng.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
quiltingboard.com quiltingboard.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
redwoodtimes.com redwoodtimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
reginaballhockey.com reginaballhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 141 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
rhodyrampage.com rhodyrampage.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
rickheinz.com rickheinz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
arbroath-mad.co.uk arbroath-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 64 days
ORC ORC-402 Jul 2019 Aug 2019 15 days
rmx.com.mx rmx.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 141 days
FWHL FWHL-762737 Jul 2019 Aug 2019 32 days
readceltic.com readceltic.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
bradfordcity-mad.co.uk bradfordcity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 61 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
sabrenoise.com sabrenoise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
saturdayblitz.com saturdayblitz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
catflyph.com catflyph.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 87 days
ORC ORC-402 May 2019 Jul 2019 87 days
saucyrecipes.com saucyrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 140 days
AOL AOL-6748 Jul 2019 Aug 2019 52 days
seamsandscissors.com seamsandscissors.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
shabdkosh.com shabdkosh.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 139 days
FWHL FWHL-762737 May 2019 May 2019 One Off
arrowheadaddict.com arrowheadaddict.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
allfreecasserolerecipes.com allfreecasserolerecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
allfreediyweddings.com allfreediyweddings.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
am66g.com am66g.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
simbaly.com simbaly.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 91 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
ankaclan.com ankaclan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
IEX IEX-189205 Sep 2019 Sep 2019 One Off
slamonline.com slamonline.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
ORC ORC-402 Jun 2019 Jul 2019 48 days
slotbackwaggle.com slotbackwaggle.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 47 days
FWHL FWHL-762769 Sep 2019 Oct 2019 38 days
smdsc.com.au smdsc.com.au
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
aptoslife.com aptoslife.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Sep 2019 57 days
AOL AOL-6748 May 2019 Jun 2019 34 days
apmha.org apmha.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 105 days
FWHL FWHL-762737 Jul 2019 Aug 2019 16 days
sportdfw.com sportdfw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
stamfordadvocate.com stamfordadvocate.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
1007sandiego.com 1007sandiego.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
stlfinder.com stlfinder.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 37 days
PUBM PUBM-158017 Sep 2019 Oct 2019 37 days
1428elm.com 1428elm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
readligue1.com readligue1.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
advocate-news.com advocate-news.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
albat.com.mx albat.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Sep 2019 138 days
FWHL FWHL-762737 Jun 2019 Aug 2019 65 days
surfer.com surfer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
swanagefc.com swanagefc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
aspsnippets.com aspsnippets.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
taxguru.in taxguru.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 129 days
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
atozproxy.com atozproxy.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 19 days
PUBM PUBM-158017 Sep 2019 Oct 2019 19 days
teluguz.com teluguz.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 35 days
PUBM PUBM-158017 Sep 2019 Oct 2019 35 days
terezowens.com terezowens.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
tettybetty.com tettybetty.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 136 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
awkwardmom.com awkwardmom.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 124 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
ayrunited-mad.co.uk ayrunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 63 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
backgrounddownload.com backgrounddownload.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 18 days
PUBM PUBM-158017 Sep 2019 Oct 2019 18 days
therealdeal.com therealdeal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
thesixthaxis.com thesixthaxis.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
balldurham.com balldurham.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
tidbitsofexperience.com tidbitsofexperience.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
tigerland.com tigerland.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Jul 2019 49 days
baseballoshawa.com baseballoshawa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Sep 2019 57 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
bawarchi.com bawarchi.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Sep 2019 43 days
PUBM PUBM-158017 Aug 2019 Sep 2019 43 days
bbmha.ca bbmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 75 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
bearinsider.com bearinsider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 56 days
beaumontenterprise.com beaumontenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
beebom.com beebom.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
behindwoods.com behindwoods.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
travelingmom.com travelingmom.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 69 days
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
truthandaction.org truthandaction.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
ttcp5577.com ttcp5577.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
tvline.com tvline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 135 days
DM DM-100974 Jul 2019 Aug 2019 26 days
typingclub.com typingclub.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
ukiahdailyjournal.com ukiahdailyjournal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
biabcalculator.com biabcalculator.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 74 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
bikemag.com bikemag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
bikez.biz bikez.biz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
vanderhoofminorhockey.ca vanderhoofminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 134 days
FWHL FWHL-762737 May 2019 Jul 2019 48 days
blackfaldsminorhockey.com blackfaldsminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
bladenjournal.com bladenjournal.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Sep 2019 104 days
AOL AOL-6748 Sep 2019 Sep 2019 One Off
videotoolbox.com videotoolbox.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
vivaligamx.com vivaligamx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 72 days
FWHL FWHL-762769 Sep 2019 Oct 2019 31 days
bobvila.com bobvila.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
wales-mad.co.uk wales-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 24 days
ORC ORC-402 Jul 2019 Jul 2019 One Off
boundingintocomics.com boundingintocomics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 106 days
FWHL FWHL-762737 May 2019 Jun 2019 37 days
bricksareawesome.com bricksareawesome.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
whathifi.com whathifi.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 69 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
brookingsregister.com brookingsregister.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 82 days
AOL AOL-6614 Jul 2019 Oct 2019 82 days
windowscentral.com windowscentral.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
bustingbrackets.com bustingbrackets.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
wrfc.net wrfc.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
bysi.ca bysi.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 12 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
wxc-yl.com wxc-yl.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
wyrk.com wyrk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
xclient.info xclient.info
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
calltothepen.com calltothepen.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
hailfloridahail.com hailfloridahail.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
canaln.pe canaln.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
capebretontradesmen.com capebretontradesmen.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jun 2019 38 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
cardiaccane.com cardiaccane.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
care2.com care2.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
yesplz.co yesplz.co
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Sep 2019 103 days
AOL AOL-6748 Jul 2019 Oct 2019 83 days
causewaycrowd.com causewaycrowd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
ysyl222.com ysyl222.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
cincyontheprowl.com cincyontheprowl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
cityofchampionssports.com cityofchampionssports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
clintonnc.com clintonnc.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Sep 2019 104 days
AOL AOL-6614 Jun 2019 Sep 2019 104 days
cobrashockeyaa.net cobrashockeyaa.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 71 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
convertfiles.com convertfiles.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
couleeregionsledhockey.com couleeregionsledhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 120 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
cpdynamo.com cpdynamo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 59 days
AOL AOL-6748 Jun 2019 Jul 2019 49 days
craftster.org craftster.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
DM DM-100974 Jul 2019 Aug 2019 21 days
dailyarmy.com dailyarmy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Sep 2019 108 days
AOL AOL-6748 Aug 2019 Oct 2019 70 days
dailydemocrat.com dailydemocrat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
dallasobserver.com dallasobserver.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
data-base.pro data-base.pro
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 11 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dbltap.com dbltap.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
devilsindetail.com devilsindetail.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
didyouknowfacts.com didyouknowfacts.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 90 days
FWHL FWHL-762769 Sep 2019 Oct 2019 10 days
dinamalar.com dinamalar.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
dinamani.com dinamani.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 26 days
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
discuss.com.hk discuss.com.hk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
divyabhaskar.co.in divyabhaskar.co.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
dlrccricket.com dlrccricket.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Jun 2019 One Off
dwmhoa.com dwmhoa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Aug 2019 92 days
FWHL FWHL-762737 Jun 2019 Aug 2019 56 days
familyhandyman.com familyhandyman.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
einerd.com.br einerd.com.br
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 8 days
PUBM PUBM-158017 Oct 2019 Oct 2019 8 days
eldestaperadio.com eldestaperadio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Aug 2019 Aug 2019 6 days
eleconomistaamerica.co eleconomistaamerica.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
elheraldo.hn elheraldo.hn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
elsivar24.com elsivar24.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
empirewritesback.com empirewritesback.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
entertainmentdaily.co.uk entertainmentdaily.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 55 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
expressnews.com expressnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
extratimetalk.com extratimetalk.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
factoryofsadness.co factoryofsadness.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
fairfieldcitizenonline.com fairfieldcitizenonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
fantasysharks.com fantasysharks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
fashionnewsera.com fashionnewsera.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
fifthdomain.com fifthdomain.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 Aug 2019 98 days
firstcry.com firstcry.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
IEX IEX-189205 Sep 2019 Sep 2019 One Off
five2go.com five2go.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 3 days
ORC ORC-402 Aug 2019 Aug 2019 3 days
foxyoxie.com foxyoxie.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
ORC ORC-402 Aug 2019 Aug 2019 One Off
fsm-media.com fsm-media.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 3 days
ORC ORC-402 Aug 2019 Aug 2019 3 days
gem021.com gem021.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 3 days
IEX IEX-189205 Oct 2019 Oct 2019 3 days
giants365.com giants365.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
FWHL FWHL-762769 May 2019 Jun 2019 47 days
goanddomichigan.com goanddomichigan.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 49 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
gobmha.ca gobmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
goldengatesports.com goldengatesports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
harbourcitylakersringette.com harbourcitylakersringette.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 111 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
hdtuto.com hdtuto.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Aug 2019 One Off
helloabbeville.com helloabbeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloammon.com helloammon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloangleton.com helloangleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloarlington.com helloarlington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobrooklyncenter.com hellobrooklyncenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocapecod.com hellocapecod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocarbondale.com hellocarbondale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocartersville.com hellocartersville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocicero.com hellocicero.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-350746 Oct 2013 Oct 2013 One Off
hellocolleyville.com hellocolleyville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-350746 Oct 2013 Oct 2013 One Off
hellocrestwood.com hellocrestwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellodenison.com hellodenison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellododge.com hellododge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloeastlansing.com helloeastlansing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
helloeastorange.com helloeastorange.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloedmond.com helloedmond.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloedwardsville.com helloedwardsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloelkriver.com helloelkriver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogadsden.com hellogadsden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogoldenvalley.com hellogoldenvalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 229 days
UA UA-118163407 Aug 2020 Jan 2021 162 days
hellogoldsboro.com hellogoldsboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogreendale.com hellogreendale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohercules.com hellohercules.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohermiston.com hellohermiston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohiltonheadisland.com hellohiltonheadisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohollywood.com hellohollywood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohutchinson.com hellohutchinson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-350746 Oct 2013 Oct 2013 One Off
helloinkster.com helloinkster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokenner.com hellokenner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokingsville.com hellokingsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokinston.com hellokinston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
hellolahabra.com hellolahabra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolansing.com hellolansing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloleawood.com helloleawood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolemoore.com hellolemoore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloleominster.com helloleominster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellolivermore.com hellolivermore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellolyon.com hellolyon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomacon.com hellomacon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellomaplevalley.com hellomaplevalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomaryville.com hellomaryville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomattoon.com hellomattoon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomendocino.com hellomendocino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomiamilakes.com hellomiamilakes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomorganton.com hellomorganton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonetherlands.com hellonetherlands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
hellonewlondon.com hellonewlondon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellonogales.com hellonogales.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorthampton.com hellonorthampton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorthcanton.com hellonorthcanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooakharbor.com hellooakharbor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellooklahoma.com hellooklahoma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloowensboro.com helloowensboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopalmdale.com hellopalmdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloparkland.com helloparkland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloparmaheights.com helloparmaheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopaterson.com hellopaterson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Apr 2012 May 2016 4 years, 35 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopineville.com hellopineville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopinole.com hellopinole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
helloplantation.com helloplantation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportage.com helloportage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportchester.com helloportchester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportwashington.com helloportwashington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloquincy.com helloquincy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellorhodeisland.com hellorhodeisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellorussellville.com hellorussellville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosanjuancapistrano.com hellosanjuancapistrano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosanmarcos.com hellosanmarcos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosantarosa.com hellosantarosa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloschererville.com helloschererville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosouthsanfrancisco.com hellosouthsanfrancisco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellostarkville.com hellostarkville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellostatesboro.com hellostatesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosummerville.com hellosummerville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotemecula.com hellotemecula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellotrotwood.com hellotrotwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotucson.com hellotucson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
hellovadnaisheights.com hellovadnaisheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Aug 2014 2 years, 168 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellovisalia.com hellovisalia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Jun 2014 2 years, 105 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowatsonville.com hellowatsonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellowaynesboro.com hellowaynesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowestcolumbia.com hellowestcolumbia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowestland.com hellowestland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellowilliamsport.com hellowilliamsport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellozion.com hellozion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
heraldspot.com heraldspot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
hindijeevansathi.in hindijeevansathi.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
hindisahayta.in hindisahayta.in
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
hip-hopvibe.com hip-hopvibe.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 158 days
FWHL FWHL-762737 Jun 2019 Aug 2019 49 days
hiplatina.com hiplatina.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 97 days
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
hket-work.com hket-work.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
housesforrent.ws housesforrent.ws
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
houstonpress.com houstonpress.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
hrfc.ca hrfc.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 49 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
huskercorner.com huskercorner.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
iasexamportal.com iasexamportal.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 59 days
PUBM PUBM-158017 Aug 2019 Oct 2019 59 days
imleagues.com imleagues.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 96 days
iranitv.com iranitv.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 58 days
PUBM PUBM-158017 Aug 2019 Oct 2019 58 days
itsolutionstuff.com itsolutionstuff.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 58 days
java2novice.com java2novice.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 57 days
IEX IEX-189205 Aug 2019 Oct 2019 57 days
jugofsnyder.com jugofsnyder.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
kens5.com kens5.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
kingjamesgospel.com kingjamesgospel.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
lakers365.com lakers365.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 152 days
FWHL FWHL-762769 May 2019 Jun 2019 48 days
lakeshowlife.com lakeshowlife.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
laprensagrafica.com laprensagrafica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
lawlessrepublic.com lawlessrepublic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
letterboxd.com letterboxd.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
lifeandstylemag.com lifeandstylemag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
lincolncity-mad.co.uk lincolncity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 43 days
ORC ORC-402 Jun 2019 Aug 2019 43 days
luusports.com luusports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 42 days
AOL AOL-6748 Jun 2019 Jun 2019 One Off
lyrster.com lyrster.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
mainlinemedianews.com mainlinemedianews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
manacinema.com manacinema.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
marca.com marca.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
miramichiminorhockey.ca miramichiminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 101 days
AOL AOL-6748 May 2019 May 2019 One Off
mlsmultiplex.com mlsmultiplex.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
mmasucka.com mmasucka.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 11 days
IEX IEX-189205 Aug 2019 Aug 2019 11 days
montevistajournal.com montevistajournal.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 130 days
AOL AOL-6614 Sep 2019 Oct 2019 26 days
morecambe-mad.co.uk morecambe-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 40 days
ORC ORC-402 Jul 2019 Aug 2019 40 days
mybama.com mybama.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
newtonaycliffefc.co.uk newtonaycliffefc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
ninernoise.com ninernoise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
novahockey.ca novahockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 146 days
FWHL FWHL-762737 May 2019 May 2019 One Off
nsmmhl.com nsmmhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 99 days
FWHL FWHL-762737 Jul 2019 Aug 2019 38 days
numismaster.com numismaster.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Jul 2019 48 days
AOL AOL-6748 Jul 2019 Jul 2019 One Off
nvshl.org nvshl.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
nymag.com nymag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 84 days
octopusthrower.com octopusthrower.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
odishareporter.in odishareporter.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 47 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 47 days
okmagazine.com okmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
olehottytoddy.com olehottytoddy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
olsmj.com olsmj.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
omhahockey.ca omhahockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 98 days
AOL AOL-6748 May 2019 May 2019 One Off
redbluffdailynews.com redbluffdailynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
opwhl.com opwhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 144 days
FWHL FWHL-762737 May 2019 Aug 2019 83 days
paininthearsenal.com paininthearsenal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
redmarleyfc.co.uk redmarleyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
parentztalk.com parentztalk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 144 days
FWHL FWHL-762737 May 2019 Jul 2019 47 days
penslabyrinth.com penslabyrinth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
pikstagram.org pikstagram.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
plainsman.com plainsman.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 130 days
AOL AOL-6748 Jul 2019 Oct 2019 82 days
plmha.ca plmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 143 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
pokespost.com pokespost.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 143 days
FWHL FWHL-762737 Jul 2019 Aug 2019 35 days
popcrush.com popcrush.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
prajavani.net prajavani.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 44 days
FWHL FWHL-762737 Jul 2019 Aug 2019 34 days
premierballhockey.net premierballhockey.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 44 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
pressandguide.com pressandguide.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
presstelegram.com presstelegram.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
pricepanda.co.id pricepanda.co.id
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 82 days
ORC ORC-402 May 2019 Aug 2019 82 days
problitz.com problitz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 142 days
FWHL FWHL-762769 May 2019 Jul 2019 47 days
puradsi.com puradsi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 95 days
FWHL FWHL-762737 Jul 2019 Aug 2019 34 days
qqsssj.com qqsssj.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
racer.com racer.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
ran-myrosso.com ran-myrosso.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
rayscoloredglasses.com rayscoloredglasses.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
riverfrontball.com riverfrontball.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
rochakkhabare.com rochakkhabare.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 41 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 41 days
robesonian.com robesonian.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Sep 2019 56 days
AOL AOL-6614 Sep 2019 Sep 2019 One Off
acrediteounao.com acrediteounao.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 22 days
PUBM PUBM-158017 Sep 2019 Oct 2019 22 days
accessauburn.com accessauburn.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
sachhoc.com sachhoc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
saintjohnstone-mad.co.uk saintjohnstone-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 32 days
ORC ORC-402 Jul 2019 Aug 2019 32 days
sammichespsychmeds.com sammichespsychmeds.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 68 days
ORC ORC-402 Jun 2019 Aug 2019 68 days
saskatoonredwings.ca saskatoonredwings.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 92 days
FWHL FWHL-762737 Jul 2019 Aug 2019 31 days
saracensamateurrugby.com saracensamateurrugby.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
sbsun.com sbsun.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
agdaily.com agdaily.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 22 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
seattletimes.com seattletimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
airalamo.com airalamo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
senshot.com senshot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
arsenal-world.co.uk arsenal-world.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Aug 2019 Aug 2019 One Off
setalarmclock.net setalarmclock.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
allfreechristmascrafts.com allfreechristmascrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
shootforthestarshockey.com shootforthestarshockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 30 days
AOL AOL-6614 Sep 2019 Sep 2019 One Off
silverbelt.com silverbelt.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 138 days
AOL AOL-6614 Sep 2019 Oct 2019 39 days
slambasketball.ca slambasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 47 days
AOL AOL-6614 May 2019 May 2019 One Off
skyelitenews.com skyelitenews.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
spacecityscoop.com spacecityscoop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
spikeduppsychedup.com spikeduppsychedup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
sportspyder.com sportspyder.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
0199962.com 0199962.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
12thmanrising.com 12thmanrising.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
subject.com.ua subject.com.ua
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
suntamiltv.net suntamiltv.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 47 days
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
syriaohr.com syriaohr.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 36 days
PUBM PUBM-158017 Sep 2019 Oct 2019 36 days
tasteofcountry.com tasteofcountry.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
atlantafire.com atlantafire.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Oct 2019 19 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
techlearning.com techlearning.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 20 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
audiophix.com audiophix.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
aula2pl.com aula2pl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 83 days
FWHL FWHL-762737 Jun 2019 Aug 2019 63 days
awkward.com awkward.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 124 days
FWHL FWHL-762737 Jul 2019 Aug 2019 14 days
thedailymash.co.uk thedailymash.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
thejetpress.com thejetpress.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
thektog.org thektog.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Oct 2019 130 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
theprideoflondon.com theprideoflondon.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
torotimes.com torotimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
totalprosports.com totalprosports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
trivia.com trivia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 26 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
twgram.me twgram.me
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
uconndoit.com uconndoit.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 33 days
FWHL FWHL-762737 May 2019 May 2019 One Off
undeadwalking.com undeadwalking.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
bigredlouie.com bigredlouie.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
unionandblue.com unionandblue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
upscsuccess.com upscsuccess.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 33 days
PUBM PUBM-158017 Sep 2019 Oct 2019 33 days
usmagazine.com usmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
bitul.in bitul.in
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 17 days
PUBM PUBM-158017 Sep 2019 Oct 2019 17 days
viral-centre.com viral-centre.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Sep 2019 102 days
DM DM-100974 May 2019 Aug 2019 72 days
blogredmachine.com blogredmachine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
bobshideout.com bobshideout.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
boxingtribune-news.com boxingtribune-news.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Jul 2019 Aug 2019 12 days
whshl.com whshl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 132 days
FWHL FWHL-762769 May 2019 May 2019 One Off
whittierdailynews.com whittierdailynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
wiltonbulletin.com wiltonbulletin.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
bucksphoenixnc.co.uk bucksphoenixnc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 49 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
wndietcs.com wndietcs.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 30 days
PUBM PUBM-158017 Sep 2019 Oct 2019 30 days
wonderfeed.com wonderfeed.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
NEX NEX-3391 Jul 2019 Jul 2019 One Off
wpgtalkradio.com wpgtalkradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 132 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wsbs.com wsbs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wsrkfm.com wsrkfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 132 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
camberleycc.co.uk camberleycc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 87 days
ORC ORC-402 Jul 2019 Jul 2019 One Off
camhl.com camhl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
yellowjackedup.com yellowjackedup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
yourchords.com yourchords.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
catcrave.com catcrave.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
catholicnewsagency.com catholicnewsagency.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
caughtoffside.com caughtoffside.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
cbseportal.com cbseportal.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
celebritax.com celebritax.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Jun 2019 Jul 2019 49 days
cesarsway.com cesarsway.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
cgsentinel.com cgsentinel.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Sep 2019 55 days
AOL AOL-6614 Sep 2019 Oct 2019 26 days
zonazealots.com zonazealots.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
chatib.us chatib.us
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
churchpop.com churchpop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
circuitdigest.com circuitdigest.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 71 days
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 71 days
ciudad.com.ar ciudad.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Sep 2019 Oct 2019 13 days
closerweekly.com closerweekly.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
coinagereport.com coinagereport.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
coloradohometownweekly.com coloradohometownweekly.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
courttv.com courttv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 59 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
coventrycity-mad.co.uk coventrycity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 59 days
ORC ORC-402 Jun 2019 Aug 2019 59 days
cubbiescrib.com cubbiescrib.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
cufla.ca cufla.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Oct 2019 70 days
FWHL FWHL-762737 Jun 2019 Aug 2019 58 days
dailyfreeman.com dailyfreeman.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
davidlebovitz.com davidlebovitz.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
ddmba.net ddmba.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 58 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
discordhelp.net discordhelp.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Aug 2019 Aug 2019 8 days
diversitybestpractices.com diversitybestpractices.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
doctorlib.info doctorlib.info
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 9 days
PUBM PUBM-158017 Oct 2019 Oct 2019 9 days
domino.com domino.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Jul 2019 One Off
dundee-mad.co.uk dundee-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 56 days
DM DM-100974 Aug 2019 Aug 2019 7 days
eleconomistaamerica.com.ar eleconomistaamerica.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
eleconomistaamerica.com.br eleconomistaamerica.com.br
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
eluniversaldiario.com eluniversaldiario.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
emeraldcityswagger.com emeraldcityswagger.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
eptrail.com eptrail.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
esportsx.com esportsx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 153 days
FWHL FWHL-762737 Jun 2019 Aug 2019 49 days
exmouthrugby.co.uk exmouthrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
falkirk-mad.co.uk falkirk-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Aug 2019 Aug 2019 4 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
filehippo.com filehippo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
foodchannel.com foodchannel.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
forensicfilesnow.com forensicfilesnow.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 3 days
ORC ORC-402 Aug 2019 Aug 2019 3 days
fortune.com fortune.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
fraghero.com fraghero.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Aug 2019 Oct 2019 64 days
freelandfc.co.uk freelandfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 50 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 45 days
friarsonbase.com friarsonbase.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
gaara.ca gaara.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 155 days
AOL AOL-6614 Aug 2019 Aug 2019 One Off
gamesided.com gamesided.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
getsongbpm.com getsongbpm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 156 days
FWHL FWHL-762737 Jun 2019 Aug 2019 51 days
girlbossesrock.com girlbossesrock.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 2 days
ORC ORC-402 Aug 2019 Aug 2019 2 days
gogram.club gogram.club
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
goldandgopher.com goldandgopher.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
golfwrx.com golfwrx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
gonepuckwild.com gonepuckwild.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
govipersgo.com govipersgo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jun 2019 47 days
AOL AOL-6614 Aug 2019 Aug 2019 One Off
graduatez.com graduatez.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 157 days
FWHL FWHL-762769 Jun 2019 Oct 2019 112 days
gridironexperts.com gridironexperts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
gridironnewjersey.com gridironnewjersey.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
gtaall.com gtaall.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
gtaall.com.br gtaall.com.br
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
gtaall.eu gtaall.eu
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
guelphminorfootball.net guelphminorfootball.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
haribhoomi.com haribhoomi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
helloblueisland.com helloblueisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobossier.com hellobossier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobrowndeer.com hellobrowndeer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobrownwood.com hellobrownwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2014 2 years, 77 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocarlsbad.com hellocarlsbad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloceres.com helloceres.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocharlottesville.com hellocharlottesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloclemmons.com helloclemmons.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-350746 Oct 2013 Oct 2013 One Off
hellocookeville.com hellocookeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocortland.com hellocortland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocorvallis.com hellocorvallis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloculpeper.com helloculpeper.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloeastcleveland.com helloeastcleveland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloeaston.com helloeaston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellofarmington.com hellofarmington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloflight.com helloflight.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Apr 2013 1 year, 44 days
CONN CONN-102738 Jun 2019 Oct 2019 130 days
hellofortsmith.com hellofortsmith.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellogallup.com hellogallup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogautier.com hellogautier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Feb 2014 1 year, 352 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogreatbritain.com hellogreatbritain.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellogreenwood.com hellogreenwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloherndon.com helloherndon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohinesville.com hellohinesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2013 Oct 2013 227 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohuntley.com hellohuntley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-350746 Oct 2013 Oct 2013 One Off
hellokentwood.com hellokentwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokerrville.com hellokerrville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Jul 2014 2 years, 133 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloketchikan.com helloketchikan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellokiryasjoel.com hellokiryasjoel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolakejackson.com hellolakejackson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolamesa.com hellolamesa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
hellolawton.com hellolawton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellolayton.com hellolayton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolibertyville.com hellolibertyville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellolisle.com hellolisle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolittlechute.com hellolittlechute.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolovespark.com hellolovespark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomadisonville.com hellomadisonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomapleheights.com hellomapleheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellomartinsville.com hellomartinsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomarylandheights.com hellomarylandheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-350746 Feb 2012 Feb 2012 One Off
hellomiddleton.com hellomiddleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellomissoula.com hellomissoula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomountclemens.com hellomountclemens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomurfreesboro.com hellomurfreesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorthcharleston.com hellonorthcharleston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooakley.com hellooakley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloopryland.com helloopryland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopapillion.com hellopapillion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopayson.com hellopayson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloplymouth.com helloplymouth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloportorange.com helloportorange.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Jun 2014 2 years, 105 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloranchomirage.com helloranchomirage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloreading.com helloreading.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloridgeland.com helloridgeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorockyriver.com hellorockyriver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloruston.com helloruston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellosaintcloud.com hellosaintcloud.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosantamaria.com hellosantamaria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloshakerheights.com helloshakerheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellospokanevalley.com hellospokanevalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellospringboro.com hellospringboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellostaunton.com hellostaunton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosteamboatsprings.com hellosteamboatsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellostockton.com hellostockton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellostoughton.com hellostoughton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosumter.com hellosumter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotaiwan.com hellotaiwan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellothomasville.com hellothomasville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotitusville.com hellotitusville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellovannuys.com hellovannuys.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellowasco.com hellowasco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowentzville.com hellowentzville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowestminster.com hellowestminster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowheatridge.com hellowheatridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowilkes-barre.com hellowilkes-barre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowillmar.com hellowillmar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
homebrewtalk.com homebrewtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
houseofhouston.com houseofhouston.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
houstonchronicle.com houstonchronicle.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
hrmladiesfastball.ca hrmladiesfastball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 158 days
FWHL FWHL-762769 May 2019 May 2019 One Off
indiaglitz.com indiaglitz.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Sep 2019 35 days
jrbanditsaaa.com jrbanditsaaa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 107 days
FWHL FWHL-762769 Jun 2019 Aug 2019 51 days
kalakkalcinema.com kalakkalcinema.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Aug 2019 5 days
kemmerergazette.com kemmerergazette.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 153 days
AOL AOL-6614 Jun 2019 Oct 2019 106 days
kffl.com kffl.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
DM DM-100974 Jun 2019 Jun 2019 One Off
kiiitv.com kiiitv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
lapatilla.com lapatilla.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
latina.com latina.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
laurinburgexchange.com laurinburgexchange.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 82 days
AOL AOL-6614 Jul 2019 Oct 2019 82 days
lfcdata.co.uk lfcdata.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 90 days
lmhtf.com lmhtf.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
localpov.com localpov.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 150 days
FWHL FWHL-762737 Jun 2019 Aug 2019 42 days
lowellsun.com lowellsun.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
marlinmaniac.com marlinmaniac.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
meganews.mx meganews.mx
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 May 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
middlesbrough-mad.co.uk middlesbrough-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 40 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
midlevelexceptional.com midlevelexceptional.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
milehighsticking.com milehighsticking.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
militarytimes.com militarytimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
moodycountyenterprise.com moodycountyenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 148 days
AOL AOL-6748 Jul 2019 Oct 2019 101 days
morellmustangs.ca morellmustangs.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 47 days
AOL AOL-6748 Jul 2019 Jul 2019 One Off
muscleandfitness.com muscleandfitness.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
mycolombianrecipes.com mycolombianrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jun 2019 Aug 2019 69 days
mydailyviral.com mydailyviral.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 147 days
FWHL FWHL-762769 Aug 2019 Oct 2019 49 days
namechk.com namechk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
nbbha.com nbbha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 146 days
AOL AOL-6748 Aug 2019 Oct 2019 48 days
ndusc.ca ndusc.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 146 days
FWHL FWHL-762737 May 2019 Aug 2019 85 days
nnjie.com nnjie.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
nsrjhl.com nsrjhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
orlandomagicdaily.com orlandomagicdaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
rezysa.com rezysa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 141 days
FWHL FWHL-762737 May 2019 May 2019 One Off
peterhead-mad.co.uk peterhead-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 35 days
ORC ORC-402 Jul 2019 Aug 2019 35 days
phpclasses.org phpclasses.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
pilotmountainnews.com pilotmountainnews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 82 days
AOL AOL-6614 Jul 2019 Oct 2019 82 days
pocketpence.co.uk pocketpence.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
ORC ORC-402 May 2019 May 2019 One Off
prcmba.ca prcmba.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Aug 2019 99 days
FWHL FWHL-762769 May 2019 Jul 2019 48 days
percolately.com percolately.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 144 days
FWHL FWHL-762769 Aug 2019 Oct 2019 45 days
prizegrab.com prizegrab.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 82 days
AOL AOL-6748 Jul 2019 Oct 2019 82 days
punjabijeevansathi.in punjabijeevansathi.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 95 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
qysa.ca qysa.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Oct 2019 43 days
FWHL FWHL-762769 Aug 2019 Oct 2019 43 days
readhuddersfield.com readhuddersfield.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 80 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readhxh.com readhxh.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
readkingdom.com readkingdom.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
reckontalk.com reckontalk.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 42 days
PUBM PUBM-158017 Aug 2019 Oct 2019 42 days
reddevilarmada.com reddevilarmada.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 94 days
FWHL FWHL-762737 May 2019 Aug 2019 80 days
rmfhl.com rmfhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Aug 2019 100 days
FWHL FWHL-762737 Jul 2019 Aug 2019 32 days
aroundthefoghorn.com aroundthefoghorn.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
aberdeenminorhockey.ca aberdeenminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 79 days
AOL AOL-6614 Sep 2019 Oct 2019 22 days
rothiracryptowallet.com rothiracryptowallet.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 41 days
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
rslgha.ca rslgha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 140 days
AOL AOL-6748 May 2019 May 2019 One Off
rushthekop.com rushthekop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
sahlonline.ca sahlonline.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
sakaltimes.com sakaltimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 40 days
FWHL FWHL-762769 Aug 2019 Oct 2019 40 days
salud180.com salud180.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
samachar.com samachar.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
accringtonstanley-mad.co.uk accringtonstanley-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 18 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
section215.com section215.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
senbhl.net senbhl.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
sfchronicle.com sfchronicle.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
alamosanews.com alamosanews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 130 days
AOL AOL-6614 Sep 2019 Oct 2019 26 days
allcougdup.com allcougdup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 49 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
ashbridgesvolleyball.com ashbridgesvolleyball.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 159 days
FWHL FWHL-762769 Jun 2019 Sep 2019 106 days
siliconvalley.com siliconvalley.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
sixpackspeak.com sixpackspeak.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
soyfutbol.com soyfutbol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 48 days
FWHL FWHL-762769 Sep 2019 Oct 2019 38 days
soytecno.com soytecno.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 138 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
androidheadlines.com androidheadlines.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 21 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
sputnikmusic.com sputnikmusic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
srufc.com srufc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
atlallday.com atlallday.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
stitchandunwind.com stitchandunwind.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
aberdeen-mad.co.uk aberdeen-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 66 days
ORC ORC-402 Jun 2019 Aug 2019 66 days
acidigital.com acidigital.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 79 days
FWHL FWHL-762737 Jun 2019 Aug 2019 66 days
acistampa.com acistampa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Jun 2019 Aug 2019 66 days
actitudfem.com actitudfem.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 127 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
albat.com albat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Sep 2019 Oct 2019 21 days
svg.com svg.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
svha.ca svha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
alloverthehill.com alloverthehill.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
swzhockey.ca swzhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 28 days
AOL AOL-6748 Jul 2019 Jul 2019 One Off
szbjq.com szbjq.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
talking12.com talking12.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
tasteofhome.com tasteofhome.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
tellonym.me tellonym.me
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
textnow.com textnow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
autoproyecto.com autoproyecto.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
thebaltimorewire.com thebaltimorewire.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
theboot.com theboot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thehuskyhaul.com thehuskyhaul.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
aztecscricketclub.com aztecscricketclub.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 14 days
ORC ORC-402 Jul 2019 Aug 2019 14 days
baadultsoftball.com baadultsoftball.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Jul 2019 84 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
thereporteronline.com thereporteronline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
thisisfutbol.com thisisfutbol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
timesleader.com timesleader.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 130 days
AOL AOL-6614 Jul 2019 Oct 2019 82 days
timesnowtamil.com timesnowtamil.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Oct 2019 35 days
IEX IEX-189205 Sep 2019 Oct 2019 35 days
timesoccer.com timesoccer.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
IEX IEX-189205 Sep 2019 Sep 2019 One Off
tintero.com.ar tintero.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 75 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
tipchasers.com tipchasers.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Sep 2019 26 days
tokeofthetown.com tokeofthetown.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
tomahawktake.com tomahawktake.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
bcbha.com bcbha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 62 days
AOL AOL-6614 Jun 2019 Jun 2019 One Off
tri-townicearena.com tri-townicearena.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 135 days
FWHL FWHL-762737 May 2019 May 2019 One Off
twincities.com twincities.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
upliftingtoday.com upliftingtoday.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
uwants.com uwants.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
uwants.net uwants.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
birdswatcher.com birdswatcher.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
valleyofthesuns.com valleyofthesuns.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
bluelinestation.com bluelinestation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
bosoxinjection.com bosoxinjection.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
brokensilenze.net brokensilenze.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
withthefirstpick.com withthefirstpick.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
wltx.com wltx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
wokesloth.com wokesloth.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 May 2019 One Off
AOL AOL-6748 Sep 2019 Sep 2019 One Off
wreckemred.com wreckemred.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
wrexham-mad.co.uk wrexham-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 71 days
ORC ORC-402 May 2019 May 2019 One Off
wynncash11.com wynncash11.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 29 days
PUBM PUBM-158017 Sep 2019 Oct 2019 29 days
buzzypop.com buzzypop.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jun 2019 One Off
DM DM-100974 Jun 2019 Jun 2019 One Off
bvbbuzz.com bvbbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
wycombewanderers-mad.co.uk wycombewanderers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 71 days
ORC ORC-402 May 2019 Aug 2019 71 days
xmenfansite.com xmenfansite.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Oct 2019 29 days
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
casebriefs.com casebriefs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
cbhl.org cbhl.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
zetarepublic.com zetarepublic.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Oct 2019 27 days
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
ncregister.com ncregister.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
chmbarockets.com chmbarockets.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-6614 Sep 2019 Oct 2019 13 days
cirencesterhockeyclub.co.uk cirencesterhockeyclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 88 days
ORC ORC-402 May 2019 Jul 2019 88 days
citybeat.com citybeat.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 130 days
NEX NEX-3391 Jul 2019 Aug 2019 21 days
clasificadospl.com clasificadospl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 88 days
FWHL FWHL-762737 Jun 2019 Aug 2019 59 days
cngsports.ca cngsports.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
AOL AOL-6748 Sep 2019 Sep 2019 One Off
components101.com components101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 120 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 120 days
coolimba.com coolimba.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 120 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
cosmicbook.news cosmicbook.news
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
crawleyrfc.com crawleyrfc.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
csmba.ca csmba.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 119 days
FWHL FWHL-762769 May 2019 Aug 2019 89 days
cumberlandminorhockey.ca cumberlandminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Aug 2019 Aug 2019 9 days
dagenhamandredbridge-mad.co.uk dagenhamandredbridge-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 9 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
dailyholics.com dailyholics.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Aug 2019 Aug 2019 9 days
deathvalleyvoice.com deathvalleyvoice.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
delconewsnetwork.com delconewsnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
diabeteshealthpage.com diabeteshealthpage.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Oct 2019 10 days
IEX IEX-189205 Sep 2019 Sep 2019 One Off
districtondeck.com districtondeck.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
draftsite.com draftsite.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 42 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
edexlive.com edexlive.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 8 days
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
edinburghcity-mad.co.uk edinburghcity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 56 days
DM DM-100974 Aug 2019 Aug 2019 6 days
edmhunters.com edmhunters.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 8 days
PUBM PUBM-158017 Oct 2019 Oct 2019 8 days
egrfc.com egrfc.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
ehow.com.br ehow.com.br
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 49 days
SONO SONO-783272317B Jun 2019 Aug 2019 49 days
ehpenguins.org ehpenguins.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Aug 2019 92 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
ekcowhitecapsfc.co.uk ekcowhitecapsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jun 2019 43 days
ORC ORC-402 Jun 2019 Jun 2019 One Off
elbotiquin.mx elbotiquin.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 67 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
eldestapeweb.com eldestapeweb.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
eleconomista.com.mx eleconomista.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 7 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
eleconomista.net eleconomista.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Aug 2019 Aug 2019 6 days
elkintribune.com elkintribune.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Sep 2019 56 days
AOL AOL-6614 Jun 2019 Jul 2019 48 days
eltiempohoy.es eltiempohoy.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 152 days
FWHL FWHL-762737 Jun 2019 Aug 2019 55 days
emailondeck.com emailondeck.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
enpareja.com enpareja.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Aug 2019 Aug 2019 5 days
enufh.com enufh.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
examveda.com examveda.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
fightful.com fightful.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
fightmatrix.com fightmatrix.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jun 2019 45 days
FWHL FWHL-762737 Aug 2019 Aug 2019 3 days
fishersgateflyersfc.co.uk fishersgateflyersfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 95 days
ORC ORC-402 Jun 2019 Jun 2019 One Off
flameforthought.com flameforthought.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
foodieandthechef.com foodieandthechef.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 3 days
ORC ORC-402 Aug 2019 Aug 2019 3 days
foodmeanderings.com foodmeanderings.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 3 days
ORC ORC-402 Aug 2019 Aug 2019 3 days
fullmatchesandshows.com fullmatchesandshows.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
fundysoccernb.com fundysoccernb.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-6614 Oct 2019 Oct 2019 4 days
gastronomyblog.com gastronomyblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 2 days
ORC ORC-402 Aug 2019 Aug 2019 2 days
geardiary.com geardiary.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
gifimage.net gifimage.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 3 days
PUBM PUBM-158017 Oct 2019 Oct 2019 3 days
gmcacsports.org gmcacsports.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Aug 2019 97 days
FWHL FWHL-762737 Jun 2019 Aug 2019 51 days
gojhl.ca gojhl.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
goldenbearlair.com goldenbearlair.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
guacamoley.com guacamoley.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 157 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
guelphknightsbasketball.ca guelphknightsbasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Oct 2019 62 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
guiadecocinafacil.com guiadecocinafacil.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 Aug 2019 Aug 2019 1 day
hawkeyenation.com hawkeyenation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
helloalabamausa.com helloalabamausa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloalbertville.com helloalbertville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloappleton.com helloappleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Jun 2014 2 years, 105 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloashwaubenon.com helloashwaubenon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobarbuda.com hellobarbuda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobarnstable.com hellobarnstable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobellgardens.com hellobellgardens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellobigspring.com hellobigspring.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobolivia.com hellobolivia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobrawley.com hellobrawley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocollegestation.com hellocollegestation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloeasley.com helloeasley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloedgewater.com helloedgewater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloelpasoderobles.com helloelpasoderobles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloelyria.com helloelyria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloeustis.com helloeustis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloevergreenpark.com helloevergreenpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloferguson.com helloferguson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloferndale.com helloferndale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellofountainvalley.com hellofountainvalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellograndjunction.com hellograndjunction.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellohaines.com hellohaines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohibbing.com hellohibbing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohuntington.com hellohuntington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellojefferson.com hellojefferson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokenya.com hellokenya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Aug 2018 Aug 2018 One Off
hellokernersville.com hellokernersville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
hellokettering.com hellokettering.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-350746 Feb 2012 Feb 2012 One Off
hellokirksville.com hellokirksville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokirkwood.com hellokirkwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 254 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolagrange.com hellolagrange.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolagunabeach.com hellolagunabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellolakeville.com hellolakeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloleander.com helloleander.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolondon.com hellolondon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloloveland.com helloloveland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolynwood.com hellolynwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellomadera.com hellomadera.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2014 2 years, 77 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomadisonheights.com hellomadisonheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomchenry.com hellomchenry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomercerisland.com hellomercerisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomidvale.com hellomidvale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomilpitas.com hellomilpitas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellonewbrighton.com hellonewbrighton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonewzealand.com hellonewzealand.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
hellonoblesville.com hellonoblesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorris.com hellonorris.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorwood.com hellonorwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
hellonortonshores.com hellonortonshores.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooakdale.com hellooakdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooakridge.com hellooakridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Aug 2014 2 years, 168 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloofallon.com helloofallon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooran.com hellooran.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloossining.com helloossining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopapuanewguinea.com hellopapuanewguinea.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellopatterson.com hellopatterson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportales.com helloportales.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportangeles.com helloportangeles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloracine.com helloracine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloriverton.com helloriverton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorollingmeadows.com hellorollingmeadows.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosanleandro.com hellosanleandro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaukrapids.com hellosaukrapids.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloseminole.com helloseminole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosikeston.com hellosikeston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosomerville.com hellosomerville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellostrongsville.com hellostrongsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosusanville.com hellosusanville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosylvania.com hellosylvania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotaunton.com hellotaunton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotaylorsville.com hellotaylorsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotinleypark.com hellotinleypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotumwater.com hellotumwater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowestbend.com hellowestbend.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowheeling.com hellowheeling.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowhiteplains.com hellowhiteplains.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowooster.com hellowooster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hmtvlive.com hmtvlive.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 60 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 60 days
honest-food.net honest-food.net
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 69 days
DM DM-100974 Jun 2019 Aug 2019 69 days
hoopshype.com hoopshype.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 110 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
humansoftumblr.com humansoftumblr.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 158 days
FWHL FWHL-762737 Jun 2019 Aug 2019 49 days
huskerboard.com huskerboard.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
iadityak.com iadityak.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 59 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
insidetheiggles.com insidetheiggles.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
insidetheloudhouse.com insidetheloudhouse.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
instagimg.com instagimg.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 3 days
PUBM PUBM-158017 Aug 2019 Aug 2019 3 days
iqhockey.ca iqhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 47 days
AOL AOL-6748 May 2019 May 2019 One Off
jamiiforums.com jamiiforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
ORC ORC-402 Jul 2019 Aug 2019 21 days
jerusalemonline.com jerusalemonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
jigsawpuzz.com jigsawpuzz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jun 2019 48 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
jobtapu.com jobtapu.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 4 days
PUBM PUBM-158017 Aug 2019 Aug 2019 4 days
jsclasses.org jsclasses.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 56 days
PUBM PUBM-158017 Aug 2019 Oct 2019 56 days
julesburgadvocate.com julesburgadvocate.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
jyghxsm.com jyghxsm.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 45 days
AOL AOL-6614 Aug 2019 Aug 2019 One Off
kagstv.com kagstv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
kbxhockey.com kbxhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
kcentv.com kcentv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 153 days
FWHL FWHL-762737 Jun 2019 Aug 2019 45 days
kemptvillehockey.com kemptvillehockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Oct 2019 55 days
FWHL FWHL-762769 May 2019 May 2019 One Off
kora-star.tv kora-star.tv
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 55 days
PUBM PUBM-158017 Aug 2019 Oct 2019 55 days
laprensafl.com laprensafl.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jul 2019 49 days
SONO SONO-783272317B Jun 2019 Jul 2019 49 days
laptopmag.com laptopmag.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
larnerfc.com larnerfc.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 Aug 2019 91 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
leaf.tv leaf.tv
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 98 days
ORC ORC-402 May 2019 May 2019 One Off
livingsharp.com livingsharp.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
lovebackyard.com lovebackyard.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
lwofs.com lwofs.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
maariv.co.il maariv.co.il
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 150 days
AOL AOL-6748 Aug 2019 Oct 2019 52 days
mdhlmi.com mdhlmi.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 149 days
FWHL FWHL-762737 Jun 2019 Aug 2019 41 days
mentalfloss.com mentalfloss.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
ORC ORC-402 Jul 2019 Jul 2019 One Off
mtmad.es mtmad.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 39 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
musc.ca musc.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 147 days
FWHL FWHL-762769 May 2019 Oct 2019 147 days
musselburghathleticfc.co.uk musselburghathleticfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
nbcmhl.ca nbcmhl.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
nbfoa.ca nbfoa.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 146 days
AOL AOL-6614 Jul 2019 Jul 2019 One Off
netknots.com netknots.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
newsarama.com newsarama.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jun 2019 Jun 2019 One Off
nflspinzone.com nflspinzone.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
nhregister.com nhregister.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
niadd.com niadd.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 48 days
PUBM PUBM-158017 Aug 2019 Oct 2019 48 days
nlva.net nlva.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 146 days
AOL AOL-6614 Aug 2019 Oct 2019 48 days
oglecountylife.com oglecountylife.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 145 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
ohiogamefishing.com ohiogamefishing.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 21 days
AOL AOL-49648 Aug 2019 Aug 2019 One Off
onlymyhealth.com onlymyhealth.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
oyenminorhockey.com oyenminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
pelicandebrief.com pelicandebrief.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
pinedaleroundup.com pinedaleroundup.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 143 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
pippenainteasy.com pippenainteasy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
pizzabottle.com pizzabottle.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 96 days
AOL AOL-6748 May 2019 May 2019 One Off
playingfor90.com playingfor90.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
pngimage.net pngimage.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
powder.com powder.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
predlines.com predlines.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
psneurope.com psneurope.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
puckprose.com puckprose.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 81 days
FWHL FWHL-762769 Aug 2019 Oct 2019 43 days
queenofthesouth-mad.co.uk queenofthesouth-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 34 days
ORC ORC-402 Jul 2019 Aug 2019 34 days
radaronline.com radaronline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
rajasthankhabre.com rajasthankhabre.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 43 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
razorbackers.com razorbackers.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
rclchallengecup.ca rclchallengecup.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
readastonvilla.com readastonvilla.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 80 days
SONO SONO-783272317B May 2019 May 2019 One Off
readburnley.com readburnley.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 80 days
readmiddlesbrough.com readmiddlesbrough.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 80 days
SONO SONO-783272317B May 2019 May 2019 One Off
record-bee.com record-bee.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
redbirdrants.com redbirdrants.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
footymad.net footymad.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
ORC ORC-402 Jul 2019 Aug 2019 20 days
reportingkc.com reportingkc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 141 days
FWHL FWHL-762737 Jul 2019 Aug 2019 33 days
retrogamer.net retrogamer.net
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 68 days
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
reviewingthebrew.com reviewingthebrew.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
riggosrag.com riggosrag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
ripcityproject.com ripcityproject.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
risingapple.com risingapple.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
abnormalreturns.com abnormalreturns.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
apptrigger.com apptrigger.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
rmev.cn rmev.cn
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 41 days
rmfhs.ca rmfhs.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 41 days
rochesterrams.org rochesterrams.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
aberystwythleague.co.uk aberystwythleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 32 days
rollingstone.com rollingstone.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Oct 2019 82 days
achahockey.org achahockey.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
acpathletics.com acpathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 22 days
actionsportstoday.com actionsportstoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 127 days
ruathletics.com ruathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
russellvilleathletics.com russellvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
rvathletics.com rvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
saamtv.com saamtv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 41 days
aciprensa.com aciprensa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
saladoeaglenation.org saladoeaglenation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 40 days
santacruzsentinel.com santacruzsentinel.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
saskatoonwild.com saskatoonwild.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
savingcountrymusic.com savingcountrymusic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
sciencealert.com sciencealert.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
scoopduck.com scoopduck.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 139 days
scottbulldogs.org scottbulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 40 days
aggieathletics.org aggieathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 56 days
secretui.com secretui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 139 days
sebeka-trojans.com sebeka-trojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 40 days
sedmha.com sedmha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
sefha.ca sefha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jul 2019 One Off
akronnewsreporter.com akronnewsreporter.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
sepiratesathletics.com sepiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 40 days
alternateuni.com alternateuni.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
sfasawmill.com sfasawmill.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 92 days
shaalaa.com shaalaa.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 39 days
allfreesewing.com allfreesewing.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
albumoftheyear.org albumoftheyear.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
sicem365.com sicem365.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 139 days
sircharlesincharge.com sircharlesincharge.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
sjraidersathletics.com sjraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
anfieldindex.com anfieldindex.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
anfieldleague.co.uk anfieldleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
smnwcougars.com smnwcougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 91 days
soapoperadigest.com soapoperadigest.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
soaringtoglory.com soaringtoglory.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
sojo1049.com sojo1049.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
sonichits.com sonichits.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
soobluedevils.com soobluedevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
southjerseylocalnews.com southjerseylocalnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
southsidelynx.com southsidelynx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
spartanation300.com spartanation300.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
splitsider.com splitsider.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
spnhunters.com spnhunters.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 77 days
sportressofblogitude.com sportressofblogitude.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
sportsgrid.com sportsgrid.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
sportsmashup.com sportsmashup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
sportsradio1250.com sportsradio1250.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
spstallions.com spstallions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
sputnamathletics.com sputnamathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
staffordshirecsl.co.uk staffordshirecsl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 100 days
arvadawestsports.com arvadawestsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 76 days
stcharlessports.com stcharlessports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
1280ksli.com 1280ksli.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
stokecity-mad.co.uk stokecity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 29 days
stormininnorman.com stormininnorman.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
stvmathletics.com stvmathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
suitlandathletics.com suitlandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
adjfa.org.uk adjfa.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
adnmujer.com.ar adnmujer.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 49 days
summerfieldathletics.com summerfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
afflfootball.com afflfootball.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 127 days
super9.org super9.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 28 days
alt1057albany.com alt1057albany.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
swagvilla.com swagvilla.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
swanseacity-mad.co.uk swanseacity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Aug 2019 28 days
swarmandsting.com swarmandsting.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
svcardinals.com svcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
svhsathletics.org svhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
svmhl.ca svmhl.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 137 days
syracusetitansstrong.com syracusetitansstrong.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
taftathletics.com taftathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 36 days
taftraiderathletics.com taftraiderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 36 days
atascaderonews.com atascaderonews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Sep 2019 104 days
taylortitansathletics.com taylortitansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 36 days
atlasetut.com atlasetut.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
tctrojanpride.com tctrojanpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
tecumsehathletics.com tecumsehathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
telva.com telva.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 136 days
templetonlife.com templetonlife.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Jul 2019 48 days
texags.com texags.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
avilabeachlifenews.com avilabeachlifenews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Jun 2019 One Off
tfln.co tfln.co
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Oct 2019 35 days
awimb.com awimb.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 63 days
aynorbluejackets.net aynorbluejackets.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 57 days
theclemsoninsider.com theclemsoninsider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
theclintonjournal.com theclintonjournal.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 129 days
therockofrochester.com therockofrochester.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thevikingage.com thevikingage.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
ballparksofbaseball.com ballparksofbaseball.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
thsathletics.org thsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
tigardtigers.com tigardtigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
tigerbait.com tigerbait.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 136 days
tips-and-tricks.co tips-and-tricks.co
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 May 2019 Aug 2019 75 days
tiptonathletics.com tiptonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
tlhannasports.com tlhannasports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 35 days
bathcountyathletics.com bathcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
baycitywesternathletics.com baycitywesternathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
topclassactions.com topclassactions.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
total49ers.com total49ers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalavalanche.com totalavalanche.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
totalbig12.com totalbig12.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalblackhawks.com totalblackhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
totalbluejays.com totalbluejays.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
totalbulls.com totalbulls.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
totaldallascowboys.com totaldallascowboys.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totaldevils.com totaldevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalducks.com totalducks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
totalhawks.com totalhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 34 days
totalminnesotawild.com totalminnesotawild.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
totalmonarchs.com totalmonarchs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalredsox.com totalredsox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalredwings.com totalredwings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
totalsox.com totalsox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalutahjazz.com totalutahjazz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
beedzp.com beedzp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
trojanpride.net trojanpride.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
tsmguestwriters.com tsmguestwriters.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
besthealthmag.ca besthealthmag.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
tutsmake.com tutsmake.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
tvhsgoldenbearathletics.com tvhsgoldenbearathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
tvmaze.com tvmaze.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 33 days
tvseriesfinale.com tvseriesfinale.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
twolvesathletics.com twolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
ucityathletics.com ucityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 54 days
bglancers.com bglancers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
uhstitansathletics.com uhstitansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
bhssports.com bhssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
ultimatemetallica.com ultimatemetallica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
uncached.com uncached.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 134 days
uni-watch.com uni-watch.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
uprepathletics.net uprepathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 86 days
uptotheminutemen.com uptotheminutemen.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 73 days
usssalive.com usssalive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
usweekly.world usweekly.world
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
vandaliabutlerathletics.com vandaliabutlerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 86 days
bladesofteal.com bladesofteal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
blic.rs blic.rs
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
vfathletics.com vfathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 32 days
victorybellrings.com victorybellrings.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
vidaprimo.com vidaprimo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
vidmax.com vidmax.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Oct 2019 26 days
voicenews.com voicenews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
vrwolvesathletics.com vrwolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
waggenerathletics.com waggenerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
waldronathletics.com waldronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wammnation.com wammnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wapahaniathletics.com wapahaniathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wasatchhighathletics.com wasatchhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wbathletics.org wbathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wcyy.com wcyy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wcsramsathletics.com wcsramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 30 days
wauseonsports.org wauseonsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
waynedaleathletics.com waynedaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
waynedupree.com waynedupree.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
bouldercityathletics.com bouldercityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 16 days
weareauburndaleathletics.com weareauburndaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
weartesters.com weartesters.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
wdbqam.com wdbqam.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
wdhifm.com wdhifm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
weldcentralrebels.com weldcentralrebels.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
brewersfriend.com brewersfriend.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bridgendanddistrictsfl.co.uk bridgendanddistrictsfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
westashleyathletics.org westashleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
wghathletics.org wghathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 30 days
wgrd.com wgrd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
wfaa.com wfaa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
wheatfieldblades.com wheatfieldblades.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
brooklynvegan.com brooklynvegan.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
winamacathletics.com winamacathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
winsloecharlottetownfc.ca winsloecharlottetownfc.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 84 days
wizofawes.com wizofawes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
wlalacrosse.com wlalacrosse.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 132 days
wlathletics.com wlathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 30 days
wmcsports.org wmcsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wnbf.com wnbf.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
wnhsathletics.com wnhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
bumblebeenation.com bumblebeenation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
womiowensboro.com womiowensboro.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
woodburnbulldogs.com woodburnbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 30 days
woodhavenathletics.com woodhavenathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
burlingameathletics.com burlingameathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
worldometers.info worldometers.info
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
wossmanwildcatsathletics.com wossmanwildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wowinterface.com wowinterface.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
wrrv.com wrrv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wtbdfm.com wtbdfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
wuhanshengqiao.com wuhanshengqiao.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Sep 2019 One Off
wtol.com wtol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 71 days
bvathletics.net bvathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
byfa.ca byfa.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 122 days
cacavaliers.com cacavaliers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
wythemaroons.org wythemaroons.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 29 days
cajathletics.com cajathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
xeniaathletics.com xeniaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
calgaryroyalsaa.com calgaryroyalsaa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Jun 2019 One Off
xlcountry.com xlcountry.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
gunnathletics.com gunnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
xxiuw.com xxiuw.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
xxlmag.com xxlmag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
canyonathletics.org canyonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
yeoviltown-mad.co.uk yeoviltown-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
ygoprodeck.com ygoprodeck.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 131 days
catcountry1029.com catcountry1029.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
cbs8.com cbs8.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
cccsathletics.com cccsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
cedargroveathletics.com cedargroveathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
zeelandeastsports.com zeelandeastsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
celebrityborn.com celebrityborn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 14 days
celebrityz.xyz celebrityz.xyz
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 Jun 2019 38 days
centervilleelkathletics.com centervilleelkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
am.com.mx am.com.mx
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
rt.com rt.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 81 days
chschieftains.com chschieftains.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
chscoyotes.org chscoyotes.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
chsreddevils.com chsreddevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
chswarriors.org chswarriors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
ciceroprepathletics.com ciceroprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
classicrock1051.com classicrock1051.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
classicrock961.com classicrock961.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
clonesconfidential.com clonesconfidential.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
clumberpark.cc clumberpark.cc
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
clyde-mad.co.uk clyde-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 10 days
coco7.online coco7.online
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
comicsalliance.com comicsalliance.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
craftpaperscissors.com craftpaperscissors.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
crash.net crash.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
creativeplanetnetwork.com creativeplanetnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
crockathletics.com crockathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
crossingbroad.com crossingbroad.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
crriverhawks.com crriverhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
culinarykitchenchicago.com culinarykitchenchicago.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 147 days
cvathletics.org cvathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
cwncathletics.org cwncathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
cyanogenmods.org cyanogenmods.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
dailynews.com dailynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
dalevillesports.com dalevillesports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
darientimes.com darientimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
dchawks.com dchawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 69 days
dctigersathletics.com dctigersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 69 days
delcotimes.com delcotimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
derbyathletics.com derbyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 69 days
dewittathletics.com dewittathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 10 days
dewtour.com dewtour.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Sep 2019 149 days
dfa-ifleague.co.uk dfa-ifleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
dhswildcatnation.com dhswildcatnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
djcup.ca djcup.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Oct 2019 69 days
dlmha.ca dlmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 118 days
dobberprospects.com dobberprospects.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 9 days
dpsdunbarathletics.com dpsdunbarathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
dramha.com dramha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Aug 2019 49 days
dundeerugby.co.uk dundeerugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
durhamwestjr.com durhamwestjr.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
eastfife-mad.co.uk eastfife-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 6 days
ecvbraves.com ecvbraves.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
edhspanthers.com edhspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 8 days
ehhsathletics.com ehhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
eldeber.com.bo eldeber.com.bo
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
eldeber.pro eldeber.pro
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
elecodiario.mobi elecodiario.mobi
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
elginwildcatathletics.com elginwildcatathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
eltoroathletics.com eltoroathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 66 days
elyriaathletics.org elyriaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 7 days
emeraldathletics.com emeraldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 66 days
energytv.es energytv.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 66 days
eplfootballmatch.com eplfootballmatch.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
esportsgags.com esportsgags.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 6 days
evansvilleharrisonathletics.com evansvilleharrisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
exetercity-mad.co.uk exetercity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 54 days
fadeawayworld.com fadeawayworld.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 65 days
fanspeak.com fanspeak.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
fantasyrundown.com fantasyrundown.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
fascinately.com fascinately.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
favehealthyrecipes.com favehealthyrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
fayettevilleathletics.com fayettevilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
fearthestingihs.org fearthestingihs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
fgrirish.com fgrirish.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
fhsindians.com fhsindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
fhswildcats.com fhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 5 days
fitness-singles.com fitness-singles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
foleyathletics.com foleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 4 days
footballtransfertavern.com footballtransfertavern.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
forumblueandgold.com forumblueandgold.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
fulham-mad.co.uk fulham-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 52 days
fulltimefantasy.com fulltimefantasy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
futbolmundial.com futbolmundial.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
gainesvilleredelephantathletics.com gainesvilleredelephantathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
ganeshagiantsathletics.com ganeshagiantsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gardeningknowhow.com gardeningknowhow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
garnetandcocky.com garnetandcocky.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
gateshead-fc.com gateshead-fc.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Aug 2019 Aug 2019 One Off
gavitathletics.com gavitathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gaylordathletics.com gaylordathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
gbmwolverine.com gbmwolverine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
gchsgreyhounds.com gchsgreyhounds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 3 days
geauxbulldogs.com geauxbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
gechnas.ru gechnas.ru
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Oct 2019 Oct 2019 One Off
geeksmate.io geeksmate.io
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 60 days
georgetakei.com georgetakei.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
mhs-mavericks.com mhs-mavericks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
ghathletics.org ghathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
ghsvikings.com ghsvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
girardindians.org girardindians.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gjhssports.com gjhssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 3 days
glasgowcollegesfa.co.uk glasgowcollegesfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
glencoeathletics.com glencoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
glynncountyathletics.com glynncountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
gmtoday.com gmtoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
goaustinhighathletics.com goaustinhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goballardbruins.com goballardbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gocentennialathletics.com gocentennialathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gocometsathletics.com gocometsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goeastmark.com goeastmark.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goghsreddevils.com goghsreddevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gohebronathletics.com gohebronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goheightsbulldogs.com goheightsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gohutchathletics.com gohutchathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 2 days
gojoebruin.com gojoebruin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
golancerssports.com golancerssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goldderby.com goldderby.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 69 days
goldenskate.com goldenskate.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
gomarshallredhawks.com gomarshallredhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gomeritknights.com gomeritknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gomilbybuffs.com gomilbybuffs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gondolierathletics.com gondolierathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gonmbchiefs.com gonmbchiefs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gonwtigers.com gonwtigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gopatriotpride.com gopatriotpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gophhsathletics.com gophhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goramsathletics.com goramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gorangerathletics.com gorangerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goschscougars.com goschscougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goscorpionsports.com goscorpionsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goshermanbearcats.com goshermanbearcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gouctigers.com gouctigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gowildcatsports.com gowildcatsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
grcathletics.com grcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
greatheartsmontevistaathletics.org greatheartsmontevistaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
guiaturista.com.ar guiaturista.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
guyerwildcats.com guyerwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
halewoodsummerleague2019.co.uk halewoodsummerleague2019.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 110 days
halohangout.com halohangout.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
hamiltonminorhockey.com hamiltonminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
hawkathletics.net hawkathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hdbeachcams.com hdbeachcams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
hdkoora.com hdkoora.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
headcramp.com headcramp.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
helloabilene.com helloabilene.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloadrian.com helloadrian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloagourahills.com helloagourahills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloamericanfork.com helloamericanfork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloasheboro.com helloasheboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobartlesville.com hellobartlesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobath.com hellobath.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellobelfast.com hellobelfast.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellobenin.com hellobenin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellobinghamton.com hellobinghamton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobogalusa.com hellobogalusa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellocasper.com hellocasper.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellochristiansburg.com hellochristiansburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloclaremore.com helloclaremore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 Oct 2013 One Off
helloclarksville.com helloclarksville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloconroe.com helloconroe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Dec 2013 1 year, 289 days
helloconway.com helloconway.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 Oct 2013 One Off
hellocorsicana.com hellocorsicana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellocrystallake.com hellocrystallake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellodouglasville.com hellodouglasville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellodubuque.com hellodubuque.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Dec 2019 Jan 2021 1 year, 32 days
helloeaglemountain.com helloeaglemountain.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloeauclaire.com helloeauclaire.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloelcajon.com helloelcajon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloenterprise.com helloenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellofergusfalls.com hellofergusfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellofinland.com hellofinland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Feb 2012 One Off
helloflorissant.com helloflorissant.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellofoster.com hellofoster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellogastonia.com hellogastonia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloglensfalls.com helloglensfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellogulfport.com hellogulfport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloharare.com helloharare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloharrison.com helloharrison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellohayden.com hellohayden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellohays.com hellohays.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 246 days
helloinglewood.com helloinglewood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellojanesville.com hellojanesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellokankakee.com hellokankakee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellokenosha.com hellokenosha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellolackawanna.com hellolackawanna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellolacrosse.com hellolacrosse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellolargo.com hellolargo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellolarochelle.com hellolarochelle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellolaurel.com hellolaurel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellolocal.com hellolocal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellomankato.com hellomankato.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomaplegrove.com hellomaplegrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomaplewood.com hellomaplewood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomarquette.com hellomarquette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomartinique.com hellomartinique.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Mar 2020 Jan 2021 298 days
hellomason.com hellomason.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomiamigardens.com hellomiamigardens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomineralwells.com hellomineralwells.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomonterey.com hellomonterey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellomontpellier.com hellomontpellier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellomountainhome.com hellomountainhome.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomountlaketerrace.com hellomountlaketerrace.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellonatchitoches.com hellonatchitoches.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellonational.com hellonational.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellonewbern.com hellonewbern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellonewbraunfels.com hellonewbraunfels.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellonewphiladelphia.com hellonewphiladelphia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Jun 2014 2 years, 105 days
hellonewrochelle.com hellonewrochelle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloniagarafalls.com helloniagarafalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellonottingham.com hellonottingham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellooakparkvillage.com hellooakparkvillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloocoee.com helloocoee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloowasso.com helloowasso.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellopasorobles.com hellopasorobles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopewaukee.com hellopewaukee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellopleasanton.com hellopleasanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportlandmaine.com helloportlandmaine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellopoughkeepsie.com hellopoughkeepsie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloprairie.com helloprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellorichland.com hellorichland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellorocklin.com hellorocklin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosaintbarts.com hellosaintbarts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosantamonica.com hellosantamonica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellosaudiarabia.com hellosaudiarabia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellosouthlake.com hellosouthlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellotasmania.com hellotasmania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloturkey.com helloturkey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellounitedarabemirates.com hellounitedarabemirates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellovacaville.com hellovacaville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloventura.com helloventura.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellovineland.com hellovineland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellowashougal.com hellowashougal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Aug 2014 2 years, 168 days
hellowaterbury.com hellowaterbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloweatherford.com helloweatherford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowilliamsburg.com hellowilliamsburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellowilloughby.com hellowilloughby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowinchester.com hellowinchester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowoodward.com hellowoodward.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloyuccavalley.com helloyuccavalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloyuma.com helloyuma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
heraldathletics.com heraldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hfathletics.com hfathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hhspatriots.org hhspatriots.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hillsboroathletics.org hillsboroathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hitchcockbulldogs.org hitchcockbulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hockeydb.com hockeydb.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
jrhsathletics.com jrhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
hotspurhq.com hotspurhq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
hoy.com.ni hoy.com.ni
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
hudsonexplorersathletics.com hudsonexplorersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
huntsvillehavoc.com huntsvillehavoc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 49 days
hurontigerathletics.com hurontigerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hvlathletics.com hvlathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
iceboltztournament.com iceboltztournament.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Jun 2019 48 days
inquisitr.com inquisitr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
islanderathletics.com islanderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 58 days
italiaflyers.com italiaflyers.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 95 days
itsfoss.com itsfoss.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
jagran.com jagran.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
jasperathletics.com jasperathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
jenisonathletics.com jenisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
jetlaggin.com jetlaggin.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 57 days
johnmarshallathletics.com johnmarshallathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
joneshighathletics.com joneshighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
joshreads.com joshreads.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
jourdantonathletics.com jourdantonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
journal-advocate.com journal-advocate.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
jvhsjaguars.com jvhsjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
kardashiandish.com kardashiandish.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Aug 2019 98 days
kcbsnewsradio.com kcbsnewsradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
kearnykomets.com kearnykomets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
kfmx.com kfmx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
kgab.com kgab.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
kgw.com kgw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 92 days
killthecablebill.com killthecablebill.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
kipptexas-sanantonioathletics.com kipptexas-sanantonioathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 55 days
klyq.com klyq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
kmmountaineers.com kmmountaineers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 55 days
kneehillminorhockey.ca kneehillminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
knighthawksathletics.com knighthawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 55 days
knightsathletics.net knightsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
knowledgedish.com knowledgedish.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
kool1017.com kool1017.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
kotaku.co.uk kotaku.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 91 days
krem.com krem.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 152 days
ksjcathletics.com ksjcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
kvue.com kvue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 105 days
kxrb.com kxrb.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
lajkar.se lajkar.se
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
lasalleprepathletics.org lasalleprepathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
lbpolyathletics.com lbpolyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
leedavisathletics.com leedavisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
leegeneralsathletics.com leegeneralsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lehiathletics.com lehiathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
leicestercity-mad.co.uk leicestercity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 43 days
letrasweb.com.br letrasweb.com.br
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
lghsathletics.com lghsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lincolnprepathletics.com lincolnprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
liteonline.com liteonline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
logopond.com logopond.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
lonestar995fm.com lonestar995fm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
losaltosathletics.org losaltosathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
losaltossports.com losaltossports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
lotrointerface.com lotrointerface.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
loudwiremusicfestival.com loudwiremusicfestival.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
lrathletics.org lrathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
luathletics.org luathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
maraudersathletics.com maraudersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
marinij.com marinij.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
matadorathletics.org matadorathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
matchendirect.fr matchendirect.fr
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 149 days
mbbuccaneers.com mbbuccaneers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mcaathletics.com mcaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mcamustangsathletics.org mcamustangsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mckinleyathletics.org mckinleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
meadowbrookathletics.com meadowbrookathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
medinaathletics.com medinaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
memorialhsathletics.com memorialhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
menscrown.com menscrown.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
metsmerizedonline.com metsmerizedonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
mix949.com mix949.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
mjsportszone.com mjsportszone.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
mmatorch.com mmatorch.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
momspresso.com momspresso.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 50 days
monctonminorbaseball.ca monctonminorbaseball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jul 2019 One Off
mountainhouseathletics.com mountainhouseathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
mqtathletics.com mqtathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
musipedia.org musipedia.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
musketeersathletics.com musketeersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
mvjaguars.com mvjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
mwhswildcats.com mwhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
myb106.com myb106.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
mymmanews.com mymmanews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
naeagles.com naeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
naibuzz.com naibuzz.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
nationalenquirer.com nationalenquirer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
ncaagamesim.com ncaagamesim.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 146 days
nchsathletics.com nchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
ncwhsathletics.com ncwhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
newschoolers.com newschoolers.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
nhseagleathletics.com nhseagleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
nihl.net nihl.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
njbeachcams.com njbeachcams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 129 days
nlaeagles.org nlaeagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
nohsathletics.com nohsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
northfieldathletics.com northfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
northwestathletics.org northwestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
nsjhl.ca nsjhl.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
nssll.ca nssll.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 38 days
nswings.net nswings.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
nuviewbridgeathletics.com nuviewbridgeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
oaathletics.org oaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
oakmountainathletics.org oakmountainathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
oakridgeathletics.com oakridgeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
ohslions.com ohslions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
okanaganathletics.ca okanaganathletics.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 145 days
olaathletics.com olaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
oldmillathletics.com oldmillathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
ooltewahathletics.com ooltewahathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
oregoncityschoolsathletics.org oregoncityschoolsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
oremhighathletics.com oremhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
osoyoosdesertclassic.com osoyoosdesertclassic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 47 days
owlsathletics.org owlsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
pacerathletics.org pacerathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
pasoroblespress.com pasoroblespress.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Sep 2019 103 days
patriotproud.net patriotproud.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
rebelstrue.com rebelstrue.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
petapixel.com petapixel.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
phhspatriotpride.com phhspatriotpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
phinphanatic.com phinphanatic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
phnhuskies.com phnhuskies.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
phoenixvillenews.com phoenixvillenews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
phpatriots.net phpatriots.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
phswarriors.com phswarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
piedmontwildcatsathletics.com piedmontwildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pikesvilleathletics.com pikesvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
piquaindiansathletics.org piquaindiansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
piratesnation.org piratesnation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
pleasantgrovevikings.com pleasantgrovevikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
pmhsfalcons.com pmhsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
ponyfans.com ponyfans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
popeathletics.com popeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
prepvolleyball.com prepvolleyball.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 129 days
prowrestling.com prowrestling.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
prowrestling.net prowrestling.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
pucksandpitchforks.com pucksandpitchforks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
pvtimes.com pvtimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
pwinsider.com pwinsider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
qchsathletics.com qchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
questionablecontent.net questionablecontent.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
quizpeek.com quizpeek.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 142 days
redbankathletics.com redbankathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
reeserocketsathletics.com reeserocketsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
register-pajaronian.com register-pajaronian.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
reviewjournal.com reviewjournal.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
ridgehockey.net ridgehockey.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
ringgoldrams.org ringgoldrams.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
ritenourathletics.com ritenourathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
river967.com river967.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
riverbluffathletics.com riverbluffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
arcadeprehacks.com arcadeprehacks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
abilenecooperathletics.org abilenecooperathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 22 days
rochellenews-leader.com rochellenews-leader.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 130 days
rock1029.com rock1029.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
romagladiatornation.com romagladiatornation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
rpp.pe rpp.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 140 days
rsvponline.mx rsvponline.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 79 days
rubbingtherock.com rubbingtherock.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
rugby365.com rugby365.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
rugbyclub9.be rugbyclub9.be
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
areavibes.com areavibes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
russbk.com russbk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
rvblazerathletics.com rvblazerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
sabrehockey.com sabrehockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
sacnilk.com sacnilk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 41 days
saddlebackathletics.com saddlebackathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
salinehornets.com salinehornets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
arhlhockey.com arhlhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 125 days
sanjuan8.com sanjuan8.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 47 days
saxonathletics.com saxonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 40 days
afyfc.co.uk afyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
scacchoops.com scacchoops.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
scarletandgame.com scarletandgame.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
scbuffalostrong.com scbuffalostrong.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 40 days
sdcavers.com sdcavers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 40 days
seagullsbaseballacademy.com seagullsbaseballacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
ahsathletics.com ahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 78 days
ahsindians.com ahsindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 78 days
ahsrocketsports.org ahsrocketsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 78 days
sentinelandenterprise.com sentinelandenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
sequoyahathletics.com sequoyahathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
seqsports.com seqsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 40 days
seventyfirstathletics.com seventyfirstathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
alohaathletics.org alohaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 77 days
sgcathletics.com sgcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
seymourathletics.com seymourathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
sfgate.com sfgate.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
aroyalpain.com aroyalpain.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
shediacminorhockey.com shediacminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
sheltonherald.com sheltonherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
allhiphop.com allhiphop.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
algonabulldogs.org algonabulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 78 days
shoresportsnetwork.com shoresportsnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
shs-falcons.com shs-falcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
shswolfpack.com shswolfpack.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
amhsraptors.com amhsraptors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 20 days
sinembargo.mx sinembargo.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
amcg.cn amcg.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
skyscraperblues.com skyscraperblues.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
slapthesign.com slapthesign.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
slcavaliers.com slcavaliers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 38 days
anthemprepathletics.com anthemprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 77 days
sneakhype.com sneakhype.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
snapguide.com snapguide.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
smpanthersports.com smpanthersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 91 days
angelswin-forum.com angelswin-forum.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
socasteeathletics.com socasteeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 91 days
soddydaisyathletics.com soddydaisyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 91 days
sofeminine.co.uk sofeminine.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
antonymsfor.com antonymsfor.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
somehow.world somehow.world
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
sooball.com sooball.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
soundersnation.com soundersnation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
soycarmin.pro soycarmin.pro
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
southceredigionjfl.co.uk southceredigionjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 138 days
southernchestercountyweeklies.com southernchestercountyweeklies.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
aplusknightsathletics.com aplusknightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
spectorshockey.net spectorshockey.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 129 days
spiritofboise.com spiritofboise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
sprmha.com sprmha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Sep 2019 One Off
arundelathletics.com arundelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 76 days
014358.com 014358.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
014490.com 014490.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
014546.com 014546.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
starsandsticks.com starsandsticks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
starcrush.com starcrush.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
stcathletics.com stcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
1027kord.com 1027kord.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
1045theteam.com 1045theteam.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
1130thetiger.com 1130thetiger.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
12newsnow.com 12newsnow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
13newsnow.com 13newsnow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
1470kyyw.com 1470kyyw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
abc10.com abc10.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
acceptthisrose.com acceptthisrose.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
acidcow.com acidcow.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
surfline.com surfline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
surfturfandmurph.com surfturfandmurph.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
allfreeknitting.com allfreeknitting.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
sweetslyrics.com sweetslyrics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
amherstfc.co.uk amherstfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
swantonathletics.org swantonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
swraidersathletics.com swraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
swtorui.com swtorui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 89 days
swwgl.co.uk swwgl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 89 days
animalgourmet.com animalgourmet.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 20 days
tabascohoy.com tabascohoy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
tabcrawler.com tabcrawler.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
tbrnews.com tbrnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
tcrams.net tcrams.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
techbulldogs.com techbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
tephockey.com tephockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
avonworthathletics.com avonworthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 76 days
thatballsouttahere.com thatballsouttahere.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
ayrshireschoolsfa.co.uk ayrshireschoolsfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
thegameraccess.com thegameraccess.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
thenewsherald.com thenewsherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
theridgefieldpress.com theridgefieldpress.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
thesmokingcuban.com thesmokingcuban.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
thetelegraph.com thetelegraph.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thomasdaleathletics.com thomasdaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
theyucatantimes.com theyucatantimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Sep 2019 One Off
thibodauxtigers.org thibodauxtigers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 35 days
banana1015.com banana1015.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thsouthsports.com thsouthsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
thunderathletics.org thunderathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 35 days
ticehurstfc.co.uk ticehurstfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
timbercreekathletics.com timbercreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
baratacademyathletics.org baratacademyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
tipofthetower.com tipofthetower.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
tippecanoeathletics.com tippecanoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
timescall.com timescall.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
titansathletics.org titansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
tjpatriotathletics.com tjpatriotathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 35 days
tohsathletics.org tohsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
bchighbearcats.com bchighbearcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
bchsdolphins.com bchsdolphins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
total911.com total911.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Aug 2019 27 days
totalbengals.com totalbengals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
totalceltics.com totalceltics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalchiefs.com totalchiefs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalcubs.com totalcubs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totaldenverbroncos.com totaldenverbroncos.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalduke.com totalduke.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalmapleleafs.com totalmapleleafs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
totalillini.com totalillini.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalindy.com totalindy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
beargoggleson.com beargoggleson.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
totalmiamiheat.com totalmiamiheat.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalpac12.com totalpac12.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
trabzonilkadimgayrimenkul.com trabzonilkadimgayrimenkul.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
beechgrove-athletics.com beechgrove-athletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
beldingathletics.com beldingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
tri-centraltrojans.com tri-centraltrojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
tri-countyathletics.com tri-countyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
bemad.es bemad.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 58 days
troyrecord.com troyrecord.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
truckerscafefood4soul.org truckerscafefood4soul.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
tscougarssports.com tscougarssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 34 days
bernieburkegolf.ca bernieburkegolf.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 17 days
tuningcult.com tuningcult.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 135 days
tvnewz.xyz tvnewz.xyz
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
twobillsdrive.com twobillsdrive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
uancx15.com uancx15.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
bexleyathletics.com bexleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
bghsathletics.com bghsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
bigblueinteractive.com bigblueinteractive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
bigcountry969.com bigcountry969.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
uovmhl.ca uovmhl.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 53 days
urbanahawksathletics.com urbanahawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 86 days
uscreditcardguide.com uscreditcardguide.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 86 days
uscscoop.com uscscoop.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 86 days
utvsl.co.uk utvsl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 48 days
bishopenglandathletics.com bishopenglandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
valleyviewtigers1.com valleyviewtigers1.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 86 days
vasjvikings.com vasjvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 86 days
veintitantos.com veintitantos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
viralcuba.com viralcuba.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 85 days
bluefm.com.ar bluefm.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
blythewoodbengals.com blythewoodbengals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
vmsa.ca vmsa.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jul 2019 One Off
volleyballpei.com volleyballpei.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
bnwr.ca bnwr.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Sep 2019 143 days
boardmanathletics.org boardmanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
bobjonesathletics.com bobjonesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
volnation.com volnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
vtvgujarati.com vtvgujarati.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 31 days
boldsky.com boldsky.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
vulture.com vulture.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
boltbeat.com boltbeat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
wabashapaches.net wabashapaches.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
bongino.com bongino.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
bosseathletics.com bosseathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
wbrz.com wbrz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jul 2019 One Off
wchseagles.com wchseagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 54 days
wchshl.com wchshl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
wcnc.com wcnc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
wdea.am wdea.am
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
bowmanathletics.org bowmanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
wearebeggs.com wearebeggs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wearenorco.org wearenorco.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wearesc.com wearesc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
boxelderathletics.com boxelderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 16 days
weselleldorado.com weselleldorado.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 30 days
wfgr.com wfgr.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
wfmynews2.com wfmynews2.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
wfnt.com wfnt.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wforum.com wforum.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 May 2019 Aug 2019 71 days
wgna.com wgna.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
whas11.com whas11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
broadneckathletics.org broadneckathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
broadstreetbuzz.com broadstreetbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
brockeaglesathletics.com brockeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
widefieldgladiators.org widefieldgladiators.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wideopencountry.com wideopencountry.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 30 days
whoabella.com whoabella.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Sep 2019 56 days
whspanthers.com whspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
brushnewstribune.com brushnewstribune.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
brvathletics.com brvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
btwathletics.com btwathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
buccaneerstrong.com buccaneerstrong.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
buckslocalnews.com buckslocalnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 86 days
winteriscoming.net winteriscoming.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
wkfr.com wkfr.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
wkmi.com wkmi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
wlvfl.co.uk wlvfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 132 days
wobm.com wobm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
wopanthers.com wopanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
wowkeren.com wowkeren.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
wpst.com wpst.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
buttscountyathletics.com buttscountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
wtsp.com wtsp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wusa9.com wusa9.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
bvayouthsoccer.com bvayouthsoccer.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Jul 2019 One Off
bwha.ca bwha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 107 days
wwfoldschool.com wwfoldschool.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Oct 2019 29 days
wykewanderers.com wykewanderers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
cafepharma.com cafepharma.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
caffeineinformer.com caffeineinformer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
cajoncowboyathletics.com cajoncowboyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
xiehui.org xiehui.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
hailwv.com hailwv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
yanksgoyard.com yanksgoyard.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
yoamoloszapatos.com yoamoloszapatos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
yovizag.com yovizag.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 28 days
catcountry1073.com catcountry1073.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
yucatan.com.mx yucatan.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 83 days
cavsathletics.com cavsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
cekingathletics.com cekingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
celebbabylaundry.com celebbabylaundry.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
zeelandwestsports.com zeelandwestsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
centralscotlandfa.co.uk centralscotlandfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
centralscottishafl.co.uk centralscottishafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
cfcolts.com cfcolts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
cgbulldogs.com cgbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
cheapism.com cheapism.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
chhuskies.com chhuskies.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jul 2019 One Off
chopchat.com chopchat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
chowderandchampions.com chowderandchampions.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
pe.com pe.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
chsfalconpride.com chsfalconpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
chsfalcons.com chsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
chslionsathletics.com chslionsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 13 days
clarets-mad.co.uk clarets-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 59 days
climbingtalshill.com climbingtalshill.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
cmaspartans.com cmaspartans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
cmh4444.com cmh4444.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
cnynews.com cnynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
collegegridirons.com collegegridirons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 129 days
cool987fm.com cool987fm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
cordcuttersnews.com cordcuttersnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
coventryathletics.org coventryathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
covers.com covers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
covinahighathletics.com covinahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
cricketpakistan.com.pk cricketpakistan.com.pk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 12 days
cronica.com.ar cronica.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 12 days
crookanddistrictleague.co.uk crookanddistrictleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
csfbl.com csfbl.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
csfda.co.uk csfda.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Aug 2019 49 days
csnbbs.com csnbbs.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
csskodiaks.com csskodiaks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
cucharasonica.com cucharasonica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 12 days
cute2w.in cute2w.in
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 11 days
daculaathletics.com daculaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
dadecountyathletics.com dadecountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Sep 2019 59 days
dailybreeze.com dailybreeze.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
dailypuppy.com dailypuppy.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dairygoatinfo.com dairygoatinfo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dakotagardenexpo.com dakotagardenexpo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
damienathletics.com damienathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
dancehallworld.net dancehallworld.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
dawgpounddaily.com dawgpounddaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
dawindycity.com dawindycity.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
dbhssports.org dbhssports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 69 days
ddotomen.co ddotomen.co
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
ddyfa.co.uk ddyfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
denmarkathletics.com denmarkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 69 days
denverpost.com denverpost.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
deshtv.in deshtv.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 10 days
dfl2009.co.uk dfl2009.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 90 days
dhsdragonsathletics.com dhsdragonsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 69 days
dhshsathletics.com dhshsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 69 days
diabloathletics.com diabloathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 69 days
dkn.tv dkn.tv
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dmwolves.com dmwolves.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 59 days
dobberhockey.com dobberhockey.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 9 days
dobbersports.com dobbersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 59 days
dobiepride.com dobiepride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
dowathletics.com dowathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
dpsbelmontathletics.com dpsbelmontathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
duvalathletics.com duvalathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
dvskyhawksathletics.com dvskyhawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
easleyathletics.com easleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
eastlansingathletics.com eastlansingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
eastviewathletics.com eastviewathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
eddiesathletics.com eddiesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
ehsathletics.org ehsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
ejeagleathletics.org ejeagleathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
eleconomista.es eleconomista.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
eleconomistaamerica.cl eleconomistaamerica.cl
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 6 days
elkhartblazersports.com elkhartblazersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
elmonteathletics.com elmonteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
embhl.ca embhl.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Oct 2019 Oct 2019 7 days
enfieldtownfootballclub.co.uk enfieldtownfootballclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jun 2019 One Off
ennislions.org ennislions.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 66 days
eqinterface.com eqinterface.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
erhsmustangathletics.com erhsmustangathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 66 days
etowahhighathletics.com etowahhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 6 days
excelsemipro.com excelsemipro.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
excelsior.com.mx excelsior.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
expansion.com expansion.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
factaholics.com factaholics.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Sep 2019 35 days
fairbornathletics.com fairbornathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
faktually.com faktually.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 59 days
fanbuzz.com fanbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 5 days
fantasyhockeygeek.com fantasyhockeygeek.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
fcflashes.com fcflashes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 5 days
fftoday.com fftoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
fftodayforums.com fftodayforums.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
finance101.com finance101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 154 days
fliernation.org fliernation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
floridaleague.com floridaleague.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
flucoathletics.com flucoathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 4 days
fmhsathletics.com fmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
footballfoundation.org footballfoundation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
forresnairnwfa.co.uk forresnairnwfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
fortmorgantimes.com fortmorgantimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
fosterfalcons.com fosterfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
foxcreekathletics.com foxcreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
foxiauto.com foxiauto.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
fullertonindiansathletics.com fullertonindiansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
funattic.com funattic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
gahannalincolnathletics.com gahannalincolnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gahrgladiators.com gahrgladiators.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gauchosportsproperties.com gauchosportsproperties.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
gbhsathletics.com gbhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gcaathletics.org gcaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gchsathletics.org gchsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
geekycamel.com geekycamel.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 159 days
geoguessr.com geoguessr.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
ghsathletics.com ghsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 3 days
gigemgazette.com gigemgazette.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
gilbertathletics.org gilbertathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
givemeasecond.com givemeasecond.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
gladewaterathletics.com gladewaterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
glendoraathletics.com glendoraathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goaliepost.com goaliepost.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
gobluedevilsports.com gobluedevilsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gocomets.net gocomets.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gocrusadersathletics.com gocrusadersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
godwinheightsathletics.com godwinheightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
goeatoneagles.com goeatoneagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gofcswarriors.com gofcswarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
golargolions.com golargolions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
golfmagic.com golfmagic.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
golfweek.com golfweek.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
gon.com gon.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
gonewalbany.com gonewalbany.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 2 days
gonwpanthers.com gonwpanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gool24.net gool24.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 59 days
gopolarbears.com gopolarbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gorattlernation.com gorattlernation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gosparkplugs.com gosparkplugs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gotaftathletics.com gotaftathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gotfhsbruins.com gotfhsbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
govalleyvikings.com govalleyvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gowilsonwildcats.com gowilsonwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gowoodbridge.org gowoodbridge.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
gphswildcats.com gphswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
grchristianeagles.com grchristianeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
greatlakesleague.org greatlakesleague.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 62 days
greenbulldogathletics.com greenbulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
griffinbearsathletics.com griffinbearsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
groceryshopforfreeatthemart.com groceryshopforfreeatthemart.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gthstitanathletics.com gthstitanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
hannity.com hannity.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
hcathletics.net hcathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
headphonereview.com headphonereview.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
helloaiken.com helloaiken.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloalice.com helloalice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloasheville.com helloasheville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloattleboro.com helloattleboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobaraboo.com hellobaraboo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobarrie.com hellobarrie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobeatrice.com hellobeatrice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobelleville.com hellobelleville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobixby.com hellobixby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobroadviewheights.com hellobroadviewheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobrokenarrow.com hellobrokenarrow.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellocentennial.com hellocentennial.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellochippewafalls.com hellochippewafalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellocolonialheights.com hellocolonialheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 Oct 2013 One Off
hellocopperascove.com hellocopperascove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellocoronado.com hellocoronado.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellocottonwoodheights.com hellocottonwoodheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Sep 2014 2 years, 196 days
hellocountryclubhills.com hellocountryclubhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellocranston.com hellocranston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellodaphne.com hellodaphne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellodaressalaam.com hellodaressalaam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellodavie.com hellodavie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 228 days
hellodeland.com hellodeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellodiamondbar.com hellodiamondbar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloeagle.com helloeagle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloemporia.com helloemporia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloengland.com helloengland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellofarmingtonhills.com hellofarmingtonhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellofortatkinson.com hellofortatkinson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellohammond.com hellohammond.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellohickory.com hellohickory.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellohopkins.com hellohopkins.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 Oct 2013 One Off
hellohugo.com hellohugo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloinvergroveheights.com helloinvergroveheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellojerseyshore.com hellojerseyshore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellokokomo.com hellokokomo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellolagunawoods.com hellolagunawoods.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellolascruces.com hellolascruces.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolenoir.com hellolenoir.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellolongview.com hellolongview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellomanassas.com hellomanassas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomeridian.com hellomeridian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellominthill.com hellominthill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomishawaka.com hellomishawaka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomurray.com hellomurray.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Dec 2013 1 year, 286 days
hellonetwork.com hellonetwork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
hellonewberlin.com hellonewberlin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellonorman.com hellonorman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellonorthaugusta.com hellonorthaugusta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellonorthridgeville.com hellonorthridgeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellonovi.com hellonovi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloolympia.com helloolympia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloorinda.com helloorinda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellopalmbeachgardens.com hellopalmbeachgardens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellopinecrest.com hellopinecrest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloporto.com helloporto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 May 2016 2 years, 209 days
hellopullman.com hellopullman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellopuntagorda.com hellopuntagorda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloranchosantamargarita.com helloranchosantamargarita.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloreedley.com helloreedley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloreunion.com helloreunion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloriyadh.com helloriyadh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellorockymount.com hellorockymount.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloroseburg.com helloroseburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellorussia.com hellorussia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaintkitts.com hellosaintkitts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaintlucia.com hellosaintlucia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosanclemente.com hellosanclemente.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloshelby.com helloshelby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosolomonislands.com hellosolomonislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosolomons.com hellosolomons.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Mar 2016 4 years, 31 days
hellosouthjordan.com hellosouthjordan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosouthpasadena.com hellosouthpasadena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellospringfield.com hellospringfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellospringville.com hellospringville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosubraal-haymah.com hellosubraal-haymah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosunnyside.com hellosunnyside.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellotroy.com hellotroy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellotwinfalls.com hellotwinfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellotworivers.com hellotworivers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloupland.com helloupland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowalker.com hellowalker.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowarsaw.com hellowarsaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellowaukegan.com hellowaukegan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowausau.com hellowausau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowestfield.com hellowestfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowestmonroe.com hellowestmonroe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowestvalleycity.com hellowestvalleycity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowheaton.com hellowheaton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellowhittier.com hellowhittier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellowoburn.com hellowoburn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloxenia.com helloxenia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloyucaipa.com helloyucaipa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
heraldo.es heraldo.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
herzindagi.com herzindagi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
heyquiz.com heyquiz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
hhla.ca hhla.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hhpboosterclub.com hhpboosterclub.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hhshoyasports.com hhshoyasports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hidalgopirates.org hidalgopirates.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
higherlevelsportsacademy.com higherlevelsportsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 110 days
hlsdsports.us hlsdsports.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hmbhsathletics.com hmbhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hokesbluffathletics.com hokesbluffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hoosierstateofmind.com hoosierstateofmind.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
hot975fm.com hot975fm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
houstononthecheap.com houstononthecheap.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
hoverugby.club hoverugby.club
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
humboldtminorhockey.ca humboldtminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
hunterr.site hunterr.site
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
huskiesathletics.org huskiesathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
ibtimes.com.au ibtimes.com.au
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
icehawkshockey.ca icehawkshockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
idabelwarriors.com idabelwarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 59 days
ifagrassrootsabc.co.uk ifagrassrootsabc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 157 days
iheartdogs.com iheartdogs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
ilovemydogsomuch.com ilovemydogsomuch.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
ilwarriors.com ilwarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 59 days
inhalesports.com inhalesports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 58 days
ringsidenews.com ringsidenews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 26 days
intouchweekly.com intouchweekly.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
ioniaathletics.com ioniaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
ironhorseathletics.net ironhorseathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 58 days
jamesclemensathletics.com jamesclemensathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
jaysjournal.com jaysjournal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
jcpantherathletics.org jcpantherathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
jeffathletics.com jeffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
jeffersonfalconathletics.com jeffersonfalconathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
jetsathletics.org jetsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
jimrome.com jimrome.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
joblo.com joblo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
jomustangathletics.com jomustangathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
jonesborocardinals.com jonesborocardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
kalamazooribfest.com kalamazooribfest.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
kayfabenews.com kayfabenews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 103 days
kearnsathletics.com kearnsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 55 days
kekbfm.com kekbfm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
kellathletics.org kellathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 55 days
kempnerathletics.com kempnerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 55 days
kentuckysportsradio.com kentuckysportsradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
kicks105.com kicks105.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
kixs.com kixs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
klaw.com klaw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
kmhk.com kmhk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
kmhlhockey.com kmhlhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
kmhsmustangathletics.net kmhsmustangathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 55 days
knightnationathletics.com knightnationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 55 days
ktemnews.com ktemnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
ktvb.com ktvb.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
lackeyathletics.com lackeyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
lafayettefightingirish.com lafayettefightingirish.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
lagunahillsathletics.com lagunahillsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
lakecityathletics.org lakecityathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
lancasterathletics.com lancasterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
laprensa.com.ni laprensa.com.ni
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
lawndaleathletics.com lawndaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
lawofficer.com lawofficer.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
lecap.net lecap.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 53 days
lecathletics.com lecathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lewiscountyathletics.com lewiscountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lewisfalconsathletics.com lewisfalconsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lhathletics.com lhathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lhshornets.com lhshornets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lhslancers.com lhslancers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lincolnprepathletics.org lincolnprepathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lingq.com lingq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
listindiario.com listindiario.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
livemusicblog.com livemusicblog.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
living101.com living101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 53 days
ljloboathletics.com ljloboathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
loogooteeathletics.com loogooteeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
losandespass.com.ar losandespass.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jun 2019 47 days
losgatosathletics.com losgatosathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
loudwire.com loudwire.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
lumsdencubs.ca lumsdencubs.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
lutonrugby.com lutonrugby.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Aug 2019 51 days
lwwathletics.com lwwathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
lynbrookathletics.com lynbrookathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
lyricsreg.com lyricsreg.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
macombdaily.com macombdaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
manchesterdutchmen.com manchesterdutchmen.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
marketrealist.com marketrealist.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 130 days
masfl.co.uk masfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 149 days
massbaychiefs.com massbaychiefs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 41 days
mavpride.com mavpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mbcaathletics.org mbcaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
mbdragonathletics.com mbdragonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mchiathletics.com mchiathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mcmustangs.com mcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
meadeathletics.com meadeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mediotiempo.com mediotiempo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
meijeraaahockey.com meijeraaahockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
merthyrtydfilafl.co.uk merthyrtydfilafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 148 days
metsminors.net metsminors.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
mitele.es mitele.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
mmhsathletics.com mmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
mmmhl.ca mmmhl.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
mmorpg.com mmorpg.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
mohawks4life.com mohawks4life.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
montereyherald.com montereyherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
moodytrojans.com moodytrojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
mostacapital3.com mostacapital3.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
mqtmutineers.com mqtmutineers.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 147 days
mrhsathletics.com mrhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
mrhsgrizzlies.org mrhsgrizzlies.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
mthfightingowls.com mthfightingowls.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
mtmorrisathletics.com mtmorrisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
munciecentralathletics.com munciecentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
munstermustangs.com munstermustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
myjournalcourier.com myjournalcourier.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
mykhel.com mykhel.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 39 days
mysanantonio.com mysanantonio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
nacionrex.com nacionrex.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 86 days
nataliasports.net nataliasports.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
nativeplanet.com nativeplanet.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
nbafullhd.com nbafullhd.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 13 days
ncacrusaders.org ncacrusaders.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
ndaeagles.org ndaeagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
ndathletics.com ndathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
ndnation.com ndnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Sep 2019 104 days
neepawaminorhockey.ca neepawaminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
newswest9.com newswest9.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
nflanalysis.net nflanalysis.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 146 days
nfldraftdiamonds.com nfldraftdiamonds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
nghsbulldogs.com nghsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
nibfanational.co.uk nibfanational.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 99 days
nickiswift.com nickiswift.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 47 days
nisoutherngirlsleague.co.uk nisoutherngirlsleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
nmhsathletics.com nmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
nnshshl.com nnshshl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 99 days
npaaathletics.com npaaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
npcmustangs.com npcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
nswildcats.com nswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
nulltx.com nulltx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
oberlinathletics.org oberlinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
oconnellathletics.com oconnellathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
oconnorathletics.com oconnorathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
ohahockey.ca ohahockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
oilerathletics.com oilerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
okotoksbasketball.ca okotoksbasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
ole.com.ar ole.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 103 days
olentangyberlinathletics.com olentangyberlinathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
red-mammoth.com red-mammoth.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Aug 2019 One Off
ondu.ru ondu.ru
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
oneidadispatch.com oneidadispatch.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
ourcatholicprayers.com ourcatholicprayers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
ovpatriots.com ovpatriots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
owhsbruins.com owhsbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
pajiba.com pajiba.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
paladins.guru paladins.guru
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 45 days
pasadenastarnews.com pasadenastarnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
pceagles.com pceagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pcepactivities.com pcepactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pcrathletics.com pcrathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
peifootball.ca peifootball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Oct 2019 45 days
pelhamhockey.com pelhamhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 48 days
pembrokeminorhockey.com pembrokeminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
reignoftroy.com reignoftroy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
petawawaminorhockey.ca petawawaminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 143 days
peterboroughunited-mad.co.uk peterboroughunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 35 days
phhsbigreds.com phhsbigreds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
phsindians.info phsindians.info
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pikecountyathletics.com pikecountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
plymouthargyle-mad.co.uk plymouthargyle-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
popaxiom.com popaxiom.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 96 days
postandcourier.com postandcourier.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
poultonprimaryleague.co.uk poultonprimaryleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
powerthesaurus.org powerthesaurus.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
prensalibre.com prensalibre.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
psdispatch.com psdispatch.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 130 days
psindians.com psindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
pswolves.com pswolves.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
pvnews.com pvnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
pwtorchlivecast.com pwtorchlivecast.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 95 days
qhubo.com qhubo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 142 days
qocougars.com qocougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
queenspark-mad.co.uk queenspark-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
ramonahighathletics.com ramonahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
ramsathletics.org ramsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
rap4ever.org rap4ever.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 48 days
rappler.com rappler.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
ravensathletics.com ravensathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
razzball.com razzball.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 33 days
buzznoble.com buzznoble.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 61 days
rncavaliers.com rncavaliers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
robotzrule.com robotzrule.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 Oct 2013 One Off
rochdale-mad.co.uk rochdale-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Aug 2019 32 days
roscoeathletics.com roscoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
royalathletics.net royalathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
roughriderathletics.net roughriderathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
roughridersports.net roughridersports.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
roverathletics.org roverathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
rowancountyvikings.com rowancountyvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
actitudfem.pro actitudfem.pro
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
cchsathletics.org cchsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 14 days
cchssports.com cchssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 14 days
rslkings.com rslkings.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 41 days
rugbydump.com rugbydump.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 41 days
rughookingmagazine.com rughookingmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
saeasports.org saeasports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
safekidsworld.org safekidsworld.org
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
adjfl.co.uk adjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
saskballhockey.com saskballhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 140 days
aecorteamer.club aecorteamer.club
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
sbisoccer.com sbisoccer.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 139 days
scpringette.com scpringette.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Aug 2019 One Off
scyl.org scyl.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 139 days
sdyfl.org sdyfl.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 139 days
alhslynx.com alhslynx.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 78 days
allaboutjazz.com allaboutjazz.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
sfbulldogathletics.com sfbulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
sgvikings.com sgvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
allfreejewelrymaking.com allfreejewelrymaking.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
alvarezeagles.com alvarezeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 77 days
shsgreyhounds.com shsgreyhounds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
shsjaguars.com shsjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
shpanthernation.com shpanthernation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
amherststeelecomets.com amherststeelecomets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 77 days
amhsathletics.com amhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 20 days
sidelionreport.com sidelionreport.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
amongtech.com amongtech.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
autzenzoo.com autzenzoo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
animalog.online animalog.online
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 16 days
smcathletics.us smcathletics.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 91 days
animesonlinebr.biz animesonlinebr.biz
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 May 2019 Jun 2019 34 days
smtitansathletics.org smtitansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 91 days
smyrnahighathletics.com smyrnahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 91 days
soaringdownsouth.com soaringdownsouth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
antonymswords.com antonymswords.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 68 days
somoskudasai.com somoskudasai.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 May 2019 Aug 2019 77 days
songtextemania.com songtextemania.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
southernathletics.org southernathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
southboundanddown.com southboundanddown.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
spacecoastdaily.com spacecoastdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
apkjelly.com apkjelly.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jul 2019 One Off
speckyboy.club speckyboy.club
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
spectator.org spectator.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
sportsplays.com sportsplays.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
sportingsota.com sportingsota.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
sswildcatactivities.com sswildcatactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
stack.com stack.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 76 days
ashburnxtreme.org ashburnxtreme.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
012763.com 012763.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
013249.com 013249.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
statliners.com statliners.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
1035kissfmboise.com 1035kissfmboise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
103kkcn.com 103kkcn.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
1073popcrush.com 1073popcrush.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
10best.com 10best.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
10fastfingers.com 10fastfingers.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
stereogum.com stereogum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
12news.com 12news.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
1520theticket.com 1520theticket.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
15a20.com.mx 15a20.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
stormthepaint.com stormthepaint.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
studio92.com studio92.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
aaskylineathletics.com aaskylineathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 79 days
stxcharge.com stxcharge.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Sep 2019 One Off
achswolvesathletics.net achswolvesathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 79 days
allfreepapercrafts.com allfreepapercrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
swanseaseniorfootballleague.co.uk swanseaseniorfootballleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 137 days
svilleathletics.com svilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
swmavs.com swmavs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
swrandolphathletics.com swrandolphathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
ancafl.co.uk ancafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
androidcentral.com androidcentral.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 21 days
apacheathletics.org apacheathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 77 days
tabs4acoustic.com tabs4acoustic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
talkchelsea.net talkchelsea.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 137 days
atalakers.com atalakers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 19 days
taringa.net taringa.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
tcwestathletics.org tcwestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 36 days
atwateraviators.com atwateraviators.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 15 days
technobuffalo.com technobuffalo.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Aug 2019 21 days
televisa.com televisa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
tenntruth.com tenntruth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
austinopiaterehab.com austinopiaterehab.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
terrapinstationmd.com terrapinstationmd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
avnetwork.com avnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
awesome923.com awesome923.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
awesome98.com awesome98.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
aydengriftonathletics.com aydengriftonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
ayersvillepilots.com ayersvillepilots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 18 days
theboombox.com theboombox.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
ayrshireafa.co.uk ayrshireafa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
theleftoversnews.com theleftoversnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
themorningsun.com themorningsun.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
therattrick.com therattrick.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
therecorddelta.com therecorddelta.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 130 days
badgerofhonor.com badgerofhonor.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
thesphl.com thesphl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
bairdbearathletics.com bairdbearathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
thhsathletics.com thhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
thisis50.com thisis50.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 48 days
thv11.com thv11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
festusathletics.com festusathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
throughthephog.com throughthephog.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
thunderousintentions.com thunderousintentions.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
tiebreaker.com tiebreaker.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
tinymixtapes.com tinymixtapes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
tippecanoevalleyathletics.com tippecanoevalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
times-standard.com times-standard.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
timesheraldonline.com timesheraldonline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
timesnowmarathi.com timesnowmarathi.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 35 days
timesunion.com timesunion.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
tisdaleminorhockey.com tisdaleminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
titanathleticshq.com titanathleticshq.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
barnsleyanddistrictjfl.co.uk barnsleyanddistrictjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
barnsleyfa.co.uk barnsleyfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
tmhswildcatsathletics.com tmhswildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
tomshardware.co.uk tomshardware.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bayathletics.org bayathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
toocool2betrue.com toocool2betrue.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 27 days
tooeleathletics.org tooeleathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 34 days
bchstigers.com bchstigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 57 days
bdltbxf.com bdltbxf.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bdyfl.co.uk bdyfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
torl.ca torl.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
tornadoathletics.org tornadoathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
tosawesttrojans.com tosawesttrojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 34 days
bealestreetbears.com bealestreetbears.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
totalsacramentokings.com totalsacramentokings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalufc.com totalufc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalwba.com totalwba.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
bedfordrock.com bedfordrock.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Jun 2019 One Off
behsathletics.com behsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
beijixingyl.net beijixingyl.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
triwestbruins.com triwestbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
trojansrugby.co.uk trojansrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
bereanathletics.org bereanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
bessemerathletics.com bessemerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
twinsdaily.com twinsdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
tycsportsplay.com tycsportsplay.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 48 days
uasdathletics.com uasdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
bfbluejays.com bfbluejays.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
uchscenturions.com uchscenturions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 33 days
uglyeaglesathletics.com uglyeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
unfinishedman.com unfinishedman.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
upbeatnews.com upbeatnews.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
unofficialnetworks.com unofficialnetworks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
bikez.com bikez.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
billiesathletics.com billiesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
binghamathletics.com binghamathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
usatodayhss.com usatodayhss.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
birdathletics.com birdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
bishopcanevinathletics.com bishopcanevinathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
bishopmoorecatholicathletics.com bishopmoorecatholicathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
bishopnollathletics.org bishopnollathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
varinaathletics.com varinaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 86 days
blackoutdallas.com blackoutdallas.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
vcscrusaderathletics.com vcscrusaderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 32 days
bleedinblue.com bleedinblue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
blpanthers.com blpanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
blscots.org blscots.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
vivaglammagazine.com vivaglammagazine.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 Aug 2019 72 days
visordown.com visordown.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
vnnplayground.com vnnplayground.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
vocesabia.biz vocesabia.biz
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
boazathletics.com boazathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
wakeupmrwest.com wakeupmrwest.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 31 days
waconiaathletics.com waconiaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
warman3on3.com warman3on3.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jul 2019 One Off
waylandunionwildcats.com waylandunionwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wearebartlett.com wearebartlett.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wearemaranatha.com wearemaranatha.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wcmha.ca wcmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 133 days
webdesignerdepot.com webdesignerdepot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
bpringette.ca bpringette.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 16 days
brcardinals.com brcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
break.com.ar break.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 49 days
weide28.com weide28.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
wendelltrojansports.com wendelltrojansports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wenonahdragonathletics.com wenonahdragonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wesleychapelathletics.com wesleychapelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
westbloomfieldathletics.com westbloomfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
westcoastconvo.com westcoastconvo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
westernpanthersports.com westernpanthersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
westfieldathletics.com westfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
wghawksactivities.com wghawksactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
whatismyipaddress.com whatismyipaddress.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
brockleycc.co.uk brockleycc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 86 days
wheelerbearcatsathletics.com wheelerbearcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 30 days
whhssports.com whhssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
whsowls.com whsowls.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wickfest.com wickfest.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
wideopeneats.com wideopeneats.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 30 days
whodatdish.com whodatdish.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
wildaaa.ca wildaaa.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Oct 2019 30 days
bryanstationathletics.com bryanstationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
bsmotoring.com bsmotoring.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
bswildcats.com bswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
winchesterfootballleague.co.uk winchesterfootballleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 102 days
btw-athletics.com btw-athletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
buckeyebucks.org buckeyebucks.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 57 days
buffzone.com buffzone.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
wnaw.com wnaw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
woodbuffaloballhockeyleague.ca woodbuffaloballhockeyleague.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 132 days
burlesonathletics.com burlesonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
worldlifestyle.com worldlifestyle.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
worldboxingnews.net worldboxingnews.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
wowhead.com wowhead.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
wpspanthers.com wpspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wrenhurricanesathletics.com wrenhurricanesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wrhsfalcons.com wrhsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wtug.com wtug.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
byroncentersports.com byroncentersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
cadetathletics.com cadetathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
wxwildcats.com wxwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wycombesaintsfc.org.uk wycombesaintsfc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 103 days
wyomingwolvesathletics.com wyomingwolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
cagepages.com cagepages.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
cahlhockey.net cahlhockey.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
camdenfutsalleague.co.uk camdenfutsalleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 87 days
dlisted.com dlisted.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
ycmha.ca ycmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 70 days
yorktownathletics.com yorktownathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 28 days
caspercowboy.com caspercowboy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
cbbtoday.com cbbtoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
celebdirtylaundry.com celebdirtylaundry.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
cfallsathletics.org cfallsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
cfhspanthers.com cfhspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
ziperto.com ziperto.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
cheapeatsthriftycrafts.com cheapeatsthriftycrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
chhsathletics.com chhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
rd.com rd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
chsathletics.net chsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 13 days
chscolts.org chscolts.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
chsgreyhounds.com chsgreyhounds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
hawkeyesathletics.com hawkeyesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
cirangers.org cirangers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
clarencevilleathletics.com clarencevilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
clemsonsportstalk.com clemsonsportstalk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
clrvynt.com clrvynt.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
clyfa.co.uk clyfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
coffmanathletics.net coffmanathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
collegefootballpoll.com collegefootballpoll.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
cometsgalaxy.com cometsgalaxy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
coogs4life.net coogs4life.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
cookandshare.com cookandshare.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Jul 2019 One Off
coppellathletics.com coppellathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
coppercountrynews.com coppercountrynews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 159 days
cosbytitansathletics.com cosbytitansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
covenantathletics.org covenantathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
cowdenbeath-mad.co.uk cowdenbeath-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 10 days
cpgha.ca cpgha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 59 days
cqst.ca cqst.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 59 days
crackberry.com crackberry.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
creativesports2.com creativesports2.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
cupertinoathletics.com cupertinoathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
cvaviators.com cvaviators.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
cvilleathletics.com cvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
cvjags.com cvjags.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
cwmods.com cwmods.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
cyclonefanatic.com cyclonefanatic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
dagelijksevideos.nl dagelijksevideos.nl
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 58 days
daily-stuff.com daily-stuff.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Aug 2019 Aug 2019 9 days
dailyconservative.com dailyconservative.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 70 days
dailyentertainmentnews.com dailyentertainmentnews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
dailytribune.com dailytribune.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
dawgpost.com dawgpost.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
dawnofthedawg.com dawnofthedawg.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
deperedeacons.com deperedeacons.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 118 days
deportivo365.com deportivo365.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
dha.com.tr dha.com.tr
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
dhscats.com dhscats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 69 days
dhsvikingsports.com dhsvikingsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 69 days
divinity.es divinity.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
dixonramsathletics.com dixonramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Sep 2019 59 days
dndtools.net dndtools.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
dovikingsathletics.com dovikingsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
downeyathletics.com downeyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
dpsmarshallathletics.com dpsmarshallathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
dpsmeadowdaleathletics.com dpsmeadowdaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
dpsponitzathletics.com dpsponitzathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
dreadnaughtathletics.com dreadnaughtathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
drivespark.com drivespark.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
drumhellerraptorshockey.com drumhellerraptorshockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
dunlapeaglesathletics.com dunlapeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
duqssportsproperties.com duqssportsproperties.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
dwightmorrowraiders.com dwightmorrowraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
eastathletics.org eastathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
eastbournerugby.com eastbournerugby.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 92 days
eastlancsleague.com eastlancsleague.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 92 days
eastthunderhawks.com eastthunderhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
eauclaireathletics.org eauclaireathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
ecaathletics.org ecaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
edgewoodmustangsathletics.com edgewoodmustangsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
editorinleaf.com editorinleaf.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
efthunderbirds.com efthunderbirds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
ehcsathletics.com ehcsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 8 days
ehs-tigers.com ehs-tigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
elfarandi.com elfarandi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 92 days
elgrafico.com elgrafico.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 129 days
elmsathletics.org elmsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
elmundo.es elmundo.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
elmwoodparkathletics.com elmwoodparkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
elsegundoathletics.com elsegundoathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 66 days
eltiempolv.com eltiempolv.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 159 days
eltrecetv.com.ar eltrecetv.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
eluniversal.com.mx eluniversal.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
eprmha.ca eprmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 7 days
esoui.com esoui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
ettingersmithmemorial.org ettingersmithmemorial.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 66 days
evansathletics.com evansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
evansvillenorthathletics.com evansvillenorthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
everythingontap.com everythingontap.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
eyesonisles.com eyesonisles.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 104 days
fabwags.com fabwags.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
fairfieldathletics.org fairfieldathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
fbschedules.com fbschedules.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
fclionathletics.com fclionathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
femalefirst.co.uk femalefirst.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
hawtcelebs.com hawtcelebs.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Oct 2019 26 days
fhcrangers.com fhcrangers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
fhs-warriors.com fhs-warriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
fightbookmma.com fightbookmma.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
filmibeat.com filmibeat.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
firefaucet.win firefaucet.win
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
fisherstigersathletics.com fisherstigersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
fonddulacbears.com fonddulacbears.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
fourfourtwo.com fourfourtwo.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jul 2019 48 days
friendlyathletics.org friendlyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
frontieracademyathletics.com frontieracademyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
frontierathletics.com frontierathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 4 days
fsusathletics.com fsusathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
fwoe.club fwoe.club
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 96 days
gaithersburgathletics.com gaithersburgathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gateshead-mad.co.uk gateshead-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Aug 2019 Aug 2019 2 days
gcak12athletics.org gcak12athletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gcaspartansports.com gcaspartansports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gchscougars.com gchscougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gcmpatriots.com gcmpatriots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
geeksided.com geeksided.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
geektyrant.com geektyrant.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
ghnorthernoaksathletics.org ghnorthernoaksathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
glendaleprepathletics.com glendaleprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
glennathletics.com glennathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
glenoakathletics.org glenoakathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gmenhq.com gmenhq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
goaviatorsathletics.com goaviatorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gobearcats.org gobearcats.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gobgnsports.com gobgnsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gobigredathletics.com gobigredathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
gobluecats.com gobluecats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gocabeacons.com gocabeacons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gocaliforniaathletics.com gocaliforniaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gocanebayathletics.net gocanebayathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gocentralindians.com gocentralindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goclarkathletics.com goclarkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gohermleigh.com gohermleigh.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goherronathletics.com goherronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gohornetsathletics.com gohornetsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 2 days
gokanelandknights.com gokanelandknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goknightsathletics.com goknightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
golakeviewsports.com golakeviewsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
golamarmustangs.com golamarmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gomhswarhawks.com gomhswarhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gomightyarabs.com gomightyarabs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gomustangathletics.com gomustangathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 2 days
goody25.com goody25.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
gopantherathletics.com gopantherathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gopaolirams.com gopaolirams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gophoenixathletics.com gophoenixathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goportageindians.com goportageindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 2 days
gorangernation.com gorangernation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gordonleeathletics.com gordonleeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goredknightathletics.org goredknightathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goroyalsgo.net goroyalsgo.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gosachristian.org gosachristian.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gotjpatsathletics.com gotjpatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
govalhalla.org govalhalla.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
govikingathletics.com govikingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goyellowjacketsathletics.com goyellowjacketsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gpucheck.com gpucheck.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 59 days
gridironnow.net gridironnow.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
gromforum.com gromforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
gstitans.com gstitans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
guiaturista.es guiaturista.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
gvgatorathletics.com gvgatorathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
halifaxhockey.ca halifaxhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
hancockcountyathletics.com hancockcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
haraiders.com haraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hardwoodhoudini.com hardwoodhoudini.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
hboilersports.com hboilersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 1 day
hcbeavers.org hcbeavers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hchshornets.com hchshornets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hddmag.com hddmag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
hdyfl.co.uk hdyfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
headcoachranking.com headcoachranking.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
heatwaved.com heatwaved.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
helloaba.com helloaba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloalliance.com helloalliance.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloalpharetta.com helloalpharetta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloalvin.com helloalvin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloamerica.com helloamerica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloamsterdam.com helloamsterdam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloanacortes.com helloanacortes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloanderson.com helloanderson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloarvada.com helloarvada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloashtabula.com helloashtabula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobarbados.com hellobarbados.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobastrop.com hellobastrop.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Aug 2014 2 years, 168 days
hellobellflower.com hellobellflower.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobellwood.com hellobellwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobelvidere.com hellobelvidere.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobillings.com hellobillings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloblaine.com helloblaine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobluesprings.com hellobluesprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobonn.com hellobonn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellobrookfield.com hellobrookfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellocayce.com hellocayce.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellochanhassen.com hellochanhassen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellochengdu.com hellochengdu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellocooper.com hellocooper.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 Oct 2013 One Off
hellodenton.com hellodenton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellodothan.com hellodothan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2014 2 years, 77 days
helloelkhart.com helloelkhart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloflowermound.com helloflowermound.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellofontana.com hellofontana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellograpevine.com hellograpevine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellogreeley.com hellogreeley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloharrisonburg.com helloharrisonburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellohazelpark.com hellohazelpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellohighpoint.com hellohighpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellohilliard.com hellohilliard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloindependence.com helloindependence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellokampala.com hellokampala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellokefalonia.com hellokefalonia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Nov 2020 29 days
hellokennewick.com hellokennewick.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
hellolewiston.com hellolewiston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloliberty.com helloliberty.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellolorain.com hellolorain.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellolynbrook.com hellolynbrook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomanchester.com hellomanchester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellomatthews.com hellomatthews.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomelrose.com hellomelrose.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellometro.com hellometro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellomountwashington.com hellomountwashington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorthroyalton.com hellonorthroyalton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloomdurman.com helloomdurman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellooperator.com hellooperator.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellooregon.com hellooregon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellophenix.com hellophenix.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellopicorivera.com hellopicorivera.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopigeonforge.com hellopigeonforge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloplattsburgh.com helloplattsburgh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloporterville.com helloporterville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloportlandme.com helloportlandme.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportlandor.com helloportlandor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopriorlake.com hellopriorlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloranchocordova.com helloranchocordova.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellorhodes.com hellorhodes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorichardson.com hellorichardson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaintmatin.com hellosaintmatin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosandsprings.com hellosandsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosandysprings.com hellosandysprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Jul 2014 2 years, 133 days
hellosapulpa.com hellosapulpa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosavage.com hellosavage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloshakopee.com helloshakopee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
helloshermanoaks.com helloshermanoaks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosierravista.com hellosierravista.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosimivalley.com hellosimivalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloskokievillage.com helloskokievillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosouthelgin.com hellosouthelgin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosouthelmonte.com hellosouthelmonte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosoweto.com hellosoweto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosterlingheights.com hellosterlingheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellosurat.com hellosurat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellotempleterrace.com hellotempleterrace.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloterrehaute.com helloterrehaute.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Mar 2014 2 years, 14 days
hellotiffin.com hellotiffin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Jun 2014 2 years, 105 days
hellotorrance.com hellotorrance.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellotupelo.com hellotupelo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellowales.com hellowales.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellowaukesha.com hellowaukesha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowaxahachie.com hellowaxahachie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Jan 2014 1 year, 317 days
hellowebstergroves.com hellowebstergroves.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowilson.com hellowilson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowinterhaven.com hellowinterhaven.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowisconsinrapids.com hellowisconsinrapids.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloxian.com helloxian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloyakima.com helloyakima.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloypsilanti.com helloypsilanti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellozachary.com hellozachary.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Sep 2014 2 years, 196 days
henryclayathletics.com henryclayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
heritagenews.com heritagenews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
hesperiaathletics.com hesperiaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hgfpl.co.uk hgfpl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
hhihsathletics.org hhihsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hightownjfl.co.uk hightownjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
hillcrestathletics.org hillcrestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hillcrestknightsathletics.com hillcrestknightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hinkleyathletics.com hinkleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hollywoodhiccups.com hollywoodhiccups.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
hookemheadlines.com hookemheadlines.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
hoopshabit.com hoopshabit.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
hooverhighathletics.com hooverhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hopevalleyleague.co.uk hopevalleyleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 158 days
hrvathletics.com hrvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
htvnativeadsolutions.com htvnativeadsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jun 2019 48 days
hudsonvilleathletics.com hudsonvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
huffmanhighschoolathletics.com huffmanhighschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hulkpop.com hulkpop.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
hurricanesathletics.com hurricanesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hvgbminorsoccer.ca hvgbminorsoccer.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 158 days
iccpathletics.org iccpathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 59 days
idcfl.co.uk idcfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 157 days
iknowthescore.co.uk iknowthescore.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 59 days
indiehoy.com indiehoy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 96 days
iphonehacks.com iphonehacks.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
irabulldogs.org irabulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 58 days
irishsportsdaily.com irishsportsdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
jdvolsathletics.com jdvolsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
jeevansathi.com jeevansathi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
jetswhiteout.com jetswhiteout.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 155 days
jgathletics.org jgathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
jichsathletics.com jichsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
jpecfalcons.com jpecfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
jwnorthathletics.org jwnorthathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
kalkaskaathletics.com kalkaskaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
kashmereathletics.com kashmereathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
kearsleyhornets.org kearsleyhornets.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
khou.com khou.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
koolfmabilene.com koolfmabilene.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
kpel965.com kpel965.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
ksdk.com ksdk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
ksenam.com ksenam.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
ksisradio.com ksisradio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
kwknights.com kwknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
lacrossepei.ca lacrossepei.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
lahstoppers.com lahstoppers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
lakenonaathletics.org lakenonaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
lamarcountyathletics.com lamarcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
lamarledger.com lamarledger.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
laplataathletics.org laplataathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
laramielive.com laramielive.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
lastwordonrugby.com lastwordonrugby.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
lavandos.pro lavandos.pro
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
lazers.ca lazers.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 151 days
lccathletics.com lccathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
lcghl.com lcghl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 90 days
lebanonathletics.com lebanonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
lebanonathletics.org lebanonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
leopardathletics.org leopardathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lhhighlanderathletics.com lhhighlanderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lhs-trojans.com lhs-trojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lickingvalleyathletics.com lickingvalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
liquiddota.com liquiddota.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jun 2019 One Off
lisburnjuniorfootballleague.co.uk lisburnjuniorfootballleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 151 days
listegaleri.com listegaleri.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
ljhuskyathletics.com ljhuskyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lmtonline.com lmtonline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
lobandsmash.com lobandsmash.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Aug 2019 97 days
londonjuniormustangs.com londonjuniormustangs.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
lorainathletics.org lorainathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
lorettoacademyathletics.com lorettoacademyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
lovepanky.com lovepanky.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 69 days
lphsathletics.net lphsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
lshsactivities.com lshsactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
ludlowathletics.org ludlowathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
lutontown-mad.co.uk lutontown-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 42 days
lyrical-nonsense.com lyrical-nonsense.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
lyricscraze.com lyricscraze.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Oct 2019 52 days
macdonaldhockey.ca macdonaldhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
manoramaonline.com manoramaonline.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
marauderathletics.com marauderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
marauderathletics.org marauderathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
matadorsportsproperties.com matadorsportsproperties.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
mchsathletics.com mchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mckayathletics.com mckayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mcmichaelathletics.com mcmichaelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mcseagles.org mcseagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
medicaldaily.com medicaldaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
melfortminorhockey.ca melfortminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 51 days
memphisathletics.com memphisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
menaulsports.com menaulsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mesquiteathletics.com mesquiteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
metasrc.com metasrc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 148 days
mhspioneers.com mhspioneers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
miamisburgathletics.com miamisburgathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
micromaxinfo.com micromaxinfo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 81 days
mid-carolinaathletics.com mid-carolinaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
middletownpress.com middletownpress.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
milacawolves.com milacawolves.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
milanathletics.com milanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
milenio.com milenio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
milfordmavs.com milfordmavs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
mixtapemonkey.com mixtapemonkey.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Aug 2019 11 days
mlspartanathletics.org mlspartanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
mmll.ca mmll.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 40 days
mmmarauders.com mmmarauders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
mmoui.com mmoui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
monashoressports.com monashoressports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
monctonminorhockey.ca monctonminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
mpanthers.com mpanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
mrhssentinels.org mrhssentinels.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
msbbulldogs.com msbbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
mtcssports.com mtcssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
mulberryathletics.com mulberryathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
murrayhsathletics.com murrayhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
musketfire.com musketfire.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
muzikum.eu muzikum.eu
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
mvcmustangs.com mvcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
mwwire.com mwwire.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 147 days
mypembrokenc.com mypembrokenc.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Oct 2019 49 days
myplainview.com myplainview.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
mzbulldogs.com mzbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
nesn.com nesn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
neuquahockey.org neuquahockey.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
nevadapreps.com nevadapreps.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jul 2019 48 days
newsd.co newsd.co
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 61 days
nflgamesim.com nflgamesim.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
nfraidersathletics.com nfraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
nhs-cougars.com nhs-cougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
nhsgladiatorsathletics.com nhsgladiatorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
nilesathletics.com nilesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
njblackhawks.com njblackhawks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
nmk.world nmk.world
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
nnusc.com nnusc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 146 days
nolanwritin.com nolanwritin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
northwesterntrojans.org northwesterntrojans.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
npftv.com npftv.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 99 days
nsfoa.ca nsfoa.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 99 days
ntbhl.ca ntbhl.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 May 2019 One Off
nwmounties.com nwmounties.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
oakridgeathletics.org oakridgeathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
objectivist.co objectivist.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
observer.com observer.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Jul 2019 48 days
ochsathletics.com ochsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
oclancerathletics.com oclancerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
oghspatriots.com oghspatriots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
ohsathletics.org ohsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
ohscardinals.com ohscardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
oldnorthbanter.com oldnorthbanter.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
olentangybravesathletics.com olentangybravesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
olentangyorangeathletics.com olentangyorangeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
olmstedfallsathletics.net olmstedfallsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
omahabryanbears.com omahabryanbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
onebarb.com onebarb.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
ontarioathletics.org ontarioathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
opelikaathletics.com opelikaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
opslens.com opslens.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 83 days
oxigeno.com.pe oxigeno.com.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 144 days
pacificwaverider.com pacificwaverider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
paintbranchathletics.org paintbranchathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
panorama.com.ve panorama.com.ve
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
paolahighschoolathletics.com paolahighschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
patsfans.com patsfans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
pawofthetiger.com pawofthetiger.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
rhylanddistrictsundayleague.co.uk rhylanddistrictsundayleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 141 days
rhsfalcons.com rhsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
pcactivities.com pcactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pcpatriotsports.com pcpatriotsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pdhsaztecs.com pdhsaztecs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pdslstoke.co.uk pdslstoke.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
pelhamhighathletics.com pelhamhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pendletonathletics.com pendletonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
riftui.com riftui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 141 days
rimathleticsactivities.com rimathleticsactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
ringettepei.ca ringettepei.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Oct 2019 42 days
perfil.com perfil.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
phsterrors.org phsterrors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pjfrfc.co.uk pjfrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
plhsfightingpointers.com plhsfightingpointers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
plnkr.co plnkr.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
plymouthchristianeagles.com plymouthchristianeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
pomonareddevilathletics.com pomonareddevilathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
pottervilleathletics.com pottervilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
powerpyx.com powerpyx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 34 days
practicalcaravan.com practicalcaravan.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 44 days
practicalmachinist.com practicalmachinist.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
prbucksports.com prbucksports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
riverforestathletics.com riverforestathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
riverhawkathletics.com riverhawkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
rittmanathletics.org rittmanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
pricepanda.com.ph pricepanda.com.ph
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 Aug 2019 82 days
progolfnow.com progolfnow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
ptpanthers.org ptpanthers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
ptwarriors.org ptwarriors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
rabbitathletics.com rabbitathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
radcliffefc.com radcliffefc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
raftaar.in raftaar.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
ramonaathletics.com ramonaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
rap-up.com rap-up.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
raptorsrapture.com raptorsrapture.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
redarrowathletics.com redarrowathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
redlandsdailyfacts.com redlandsdailyfacts.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
rnhl.ca rnhl.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Oct 2019 41 days
roeperathletics.org roeperathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
rogerbaconspartans.org rogerbaconspartans.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
ronproject.com ronproject.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
roxpile.com roxpile.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
rubidouxathletics.com rubidouxathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
sabreathletics.org sabreathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 41 days
aahuronathletics.com aahuronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 79 days
samacharjagat.com samacharjagat.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 40 days
saratogian.com saratogian.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
saskatoonballhockey.com saskatoonballhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 79 days
saturdaydownsouth.com saturdaydownsouth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
savagehumans.com savagehumans.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
addisonathletics.com addisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 78 days
sciencealert2014.com sciencealert2014.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
screencrush.com screencrush.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
searchtempest.com searchtempest.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jul 2019 48 days
ajhsprospectors.org ajhsprospectors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 21 days
akinseaglessports.com akinseaglessports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 78 days
sfhsdonsathletics.com sfhsdonsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
alternativemissoula.com alternativemissoula.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
allacronyms.com allacronyms.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
allaroundphilly.com allaroundphilly.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
sherwoodathletics.org sherwoodathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
shopforyourcause.com shopforyourcause.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
albionrovers-mad.co.uk albionrovers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 17 days
sicemdawgs.com sicemdawgs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
sickchirpse.com sickchirpse.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
allmusicals.com allmusicals.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
sjajaguars.org sjajaguars.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
amandaclearcreekathletics.com amandaclearcreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 77 days
sjhsathletics.com sjhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
skidmore-tynanathletics.com skidmore-tynanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 39 days
slantmagazine.com slantmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
smhsathletics.com smhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 91 days
smtigers.com smtigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 91 days
animanga.es animanga.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 125 days
snowflakelobosathletics.com snowflakelobosathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 38 days
sohh.com sohh.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
sodomojo.com sodomojo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
southsideshowdown.com southsideshowdown.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
andhrajyothy.com andhrajyothy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 77 days
southchristiansports.com southchristiansports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
southdearbornathletics.com southdearbornathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
spellcheck.net spellcheck.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
spjfl.co.uk spjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 138 days
sportscastr.com sportscastr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 138 days
sportschatplace.com sportschatplace.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
sprayberryathletics.com sprayberryathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
springbrookathletics.org springbrookathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
springfieldlocalathletics.com springfieldlocalathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
srfalcons.org srfalcons.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
stairwayto11.com stairwayto11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 76 days
009854.com 009854.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
014105.com 014105.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
014191.com 014191.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
014837.com 014837.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
1037thepeak.com 1037thepeak.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
1049theedge.com 1049theedge.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
1075zoofm.com 1075zoofm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
107jamz.com 107jamz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
stmaknights.com stmaknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
stranraer-mad.co.uk stranraer-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
1360binghamton.com 1360binghamton.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
1390granitecitysports.com 1390granitecitysports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
13wmaz.com 13wmaz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
1460espnyakima.com 1460espnyakima.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
ststephensathletics.org ststephensathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
stthomasringette.ca stthomasringette.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Jul 2019 One Off
summervilleathletics.com summervilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 90 days
sunderland-mad.co.uk sunderland-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
supertalk1270.com supertalk1270.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
aegean-travel.com aegean-travel.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
afcwimbledon-mad.co.uk afcwimbledon-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
ahscolts.net ahscolts.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 78 days
ajfl.org.uk ajfl.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
alagnathletics.com alagnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 78 days
swanseatigersathletics.com swanseatigersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
swbulldogs.com swbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 May 2019 One Off
aldershottown-mad.co.uk aldershottown-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 65 days
allfortennessee.com allfortennessee.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
animesonlinebr.site animesonlinebr.site
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 64 days
sztosowe.pl sztosowe.pl
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
annapolisathletics.com annapolisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 77 days
ansonrecord.com ansonrecord.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Sep 2019 One Off
apertura.com apertura.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
tabs-database.com tabs-database.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
arcadesushi.com arcadesushi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
tascosarebels.org tascosarebels.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
tbirdathletics.com tbirdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
tcnathletics.com tcnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 89 days
teamerstg.net teamerstg.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 100 days
arlingtonlionsathletics.com arlingtonlionsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 76 days
techtimes.com techtimes.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jul 2019 Jul 2019 One Off
teleantillas.com.do teleantillas.com.do
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 88 days
tempostorm.com tempostorm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
tenacityfastpitch.com tenacityfastpitch.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 75 days
australiangeographic.com.au australiangeographic.com.au
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
avforums.com avforums.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
avhshawkathletics.com avhshawkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 76 days
thechive.com thechive.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 21 days
thecouponingcouple.com thecouponingcouple.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
thefw.com thefw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thegolfnewsnet.com thegolfnewsnet.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
thepewterplank.com thepewterplank.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
thereporter.com thereporter.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
thesixersense.com thesixersense.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
thesurfersview.com thesurfersview.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 129 days
thscougarsathletics.com thscougarsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
tigernet.com tigernet.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 136 days
bamahammer.com bamahammer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
timberlandathletics.com timberlandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
timvandevall.com timvandevall.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
tkathletics.com tkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
titannationathletics.com titannationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
titansized.com titansized.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
tmba.ca tmba.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Jul 2019 One Off
baseballpress.com baseballpress.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 18 days
batesvilleathletics.com batesvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
top-law-schools.com top-law-schools.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-19139 Sep 2019 Oct 2019 26 days
tosaeastathletics.com tosaeastathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 34 days
total76ers.com total76ers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalacc.com totalacc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
totalastros.com totalastros.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalbig10.com totalbig10.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalbluejackets.com totalbluejackets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
totalbuffalobills.com totalbuffalobills.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 88 days
totalcanucks.com totalcanucks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totaldiamondbacks.com totaldiamondbacks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalgeorgiasouthern.com totalgeorgiasouthern.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
totallosangeleskings.com totallosangeleskings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
totalnwa.com totalnwa.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 34 days
totalrays.com totalrays.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 May 2019 One Off
totalsportswire.com totalsportswire.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
totaluconn.com totaluconn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
totalwhitesox.com totalwhitesox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019 135 days
bcbay.com bcbay.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 62 days
bcpfa.ca bcpfa.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
tpathletics.org tpathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 34 days
bdpsports.com bdpsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 75 days
beartrapsummerfestival.com beartrapsummerfestival.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
bedequeminorhockey.com bedequeminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
behindthebuckpass.com behindthebuckpass.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
trumanstales.com trumanstales.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
berksmontnews.com berksmontnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
tvilleathletics.com tvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 33 days
twinpeakscharteracademyathletics.com twinpeakscharteracademyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
uber-facts.com uber-facts.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 134 days
ucclfootball.co.uk ucclfootball.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
uchsathletics.com uchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
bethcenterbulldogs.com bethcenterbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
uhnd.com uhnd.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 134 days
uhsathletics.org uhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
uhsutes.com uhsutes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 87 days
ukulele-tabs.com ukulele-tabs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
ultimateclassicrock.com ultimateclassicrock.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
bhopalsamachar.com bhopalsamachar.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 17 days
bhpbears.com bhpbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
bhsathletics.org bhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
bhsbulldogs.com bhsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
upperstclairathletics.com upperstclairathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 86 days
urbo.com urbo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
usatoday.com usatoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
uwatchfreetv.online uwatchfreetv.online
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
vahsathletics.com vahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 86 days
birminghamcity-mad.co.uk birminghamcity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 13 days
vchsathletics.com vchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 86 days
venomstrikes.com venomstrikes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
blackandteal.com blackandteal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
blackhawkup.com blackhawkup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
blakeathletics.org blakeathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
bldaily.com bldaily.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
vnnsportshub.net vnnsportshub.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
vmhsathletics.com vmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
bluemanhoop.com bluemanhoop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
voiceofamarillo.com voiceofamarillo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
bobcatathletics.org bobcatathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
wainwrightminorball.ca wainwrightminorball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
walesveteransfootball.co.uk walesveteransfootball.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 133 days
bogalusalumberjacks.org bogalusalumberjacks.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 74 days
wallaseyanddistrictsfl.co.uk wallaseyanddistrictsfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 133 days
bogiceskating.com bogiceskating.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
bolde.com bolde.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Oct 2019 16 days
boltsbythebay.com boltsbythebay.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
wareshoalsathletics.com wareshoalsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
watch.bz watch.bz
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 133 days
wcbears.com wcbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wdathletics.com wdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 30 days
waukeshawarhawks.org waukeshawarhawks.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
waverlywarriorsathletics.com waverlywarriorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wawaseeathletics.com wawaseeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
wbckfm.com wbckfm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wdwmagic.com wdwmagic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
wearecamdenhs.com wearecamdenhs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 85 days
weaselzippers.us weaselzippers.us
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
bostonherald.com bostonherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
bouldercityreview.com bouldercityreview.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
bowiebulldogathletics.com bowiebulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
weboathletics.com weboathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
weddbook.com weddbook.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
bradleyathletics.org bradleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
break410.com break410.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 86 days
westalbanybulldogs.com westalbanybulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
breatheheavy.com breatheheavy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
wfhscoyoteathletics.com wfhscoyoteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 30 days
brhsjacketpride.com brhsjacketpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
wheatonknights.com wheatonknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wheelerwildcatathletics.com wheelerwildcatathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 30 days
briha.org briha.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 122 days
whynews.com whynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
wibx950.com wibx950.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
wicklowleague.com wicklowleague.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 132 days
wideopenpets.com wideopenpets.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 30 days
wideopenroads.com wideopenroads.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 30 days
willitsnews.com willitsnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
broomfieldenterprise.com broomfieldenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
wiree.live wiree.live
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bsebportal.com bsebportal.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 16 days
bsfl.co.uk bsfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
witl.com witl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
bssjaguars.com bssjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
wjathletics.org wjathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
wmtornadoes.com wmtornadoes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 84 days
buckeyevalleyathletics.com buckeyevalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
buffalo.com buffalo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 26 days
bulldogsathletics.com bulldogsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 73 days
worldsoccertalk.com worldsoccertalk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
wpdh.com wpdh.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wrkr.com wrkr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
wwltv.com wwltv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
wxcowboys.com wxcowboys.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 29 days
byacoedsoftballtournament.com byacoedsoftballtournament.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 73 days
caaleague.org caaleague.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jun 2019 One Off
caneswarning.com caneswarning.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
canoncitydailyrecord.com canoncitydailyrecord.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
capacathletics.com capacathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
capecatfish.com capecatfish.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
henrycountyathletics.com henrycountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
yorktonunitedfc.ca yorktonunitedfc.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Sep 2019 One Off
youredm.com youredm.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 70 days
ypff.co.uk ypff.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
ypsigrizzlies.com ypsigrizzlies.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 83 days
cavaliersnation.com cavaliersnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
cavernaathletics.com cavernaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
cbcmha.ca cbcmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
cbwmh.ca cbwmh.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 107 days
ncraiders.com ncraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
cedarspringsathletics.com cedarspringsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
cfbstats.com cfbstats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 82 days
checkingcreditcard.com checkingcreditcard.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
chemics.net chemics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
chhshoops.com chhshoops.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
chicoer.com chicoer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
tl.net tl.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jun 2019 One Off
chscougarathletics.com chscougarathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Oct 2019 13 days
churchillathletics.com churchillathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 72 days
cifras.com.br cifras.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
cincomas.com cincomas.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 120 days
clackamasathletics.com clackamasathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
claireandjamie.com claireandjamie.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Sep 2019 107 days
cmhornets.net cmhornets.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
cnhockey.com cnhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Oct 2019 120 days
coacht.com coacht.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
coingape.com coingape.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 59 days
company.directory company.directory
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8425488243879801 May 2019 Oct 2019 159 days
comstockparkathletics.com comstockparkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
concordhsathletics.com concordhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
coolmaterial.com coolmaterial.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
copleyathletics.org copleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
coqmoodyringette.com coqmoodyringette.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jun 2019 39 days
cougarnation.us cougarnation.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
covathletics.org covathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
coveralia.com coveralia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 129 days
cowanathletics.com cowanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
cpgophers.com cpgophers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 71 days
csgo-stats.com csgo-stats.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
cssfl.org.uk cssfl.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 89 days
cuatro.com cuatro.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
cubaheadlines.com cubaheadlines.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 58 days
cucinare.tv cucinare.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 159 days
curioushistorian.com curioushistorian.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Aug 2019 Aug 2019 9 days
cuyhtsathletics.com cuyhtsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
cvhsgrizzlies.net cvhsgrizzlies.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
cypresscreekathletics.com cypresscreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
cypruspiratesathletics.com cypruspiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 70 days
dailybulletin.com dailybulletin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
dcschoolathletics.org dcschoolathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
dealmaxx.net dealmaxx.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
deautos.com deautos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
derbycounty-mad.co.uk derbycounty-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 57 days
dfwrestaurantweek.com dfwrestaurantweek.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 149 days
nctsharknation.com nctsharknation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
diario.mx diario.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
diaspora7.com diaspora7.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
dicksonathletics.com dicksonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 69 days
dockathletics.org dockathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
doctorwhowatch.com doctorwhowatch.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
dorksideoftheforce.com dorksideoftheforce.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
dovermercurysfl.co.uk dovermercurysfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
downersgrovesouthathletics.com downersgrovesouthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
dpsstiversathletics.com dpsstiversathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
drhsjaguars.com drhsjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
driffielddistrictafl.co.uk driffielddistrictafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
dublinathletics.org dublinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
dublinathletics.us dublinathletics.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
dukereport.com dukereport.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
dunkingwithwolves.com dunkingwithwolves.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
dutchtownathletics.com dutchtownathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 68 days
ecathletics.org ecathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
eckvilleminorhockey.com eckvilleminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 56 days
economiahoy.mx economiahoy.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
ectrojansathletics.com ectrojansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
edetroit.co edetroit.co
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Jun 2019 One Off
edgewaterathletics.com edgewaterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
edgewoodcougarathletics.com edgewoodcougarathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
eelsathletics.com eelsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 8 days
efstaging.com efstaging.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
egthunderbirds.com egthunderbirds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
einsteinathletics.org einsteinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
ekfalcons.com ekfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
elcaminoathletics.org elcaminoathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 67 days
elcolombiano.com elcolombiano.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
elcomercio.com elcomercio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
elranchodons.com elranchodons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 66 days
elrincondelmiedo.com elrincondelmiedo.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Aug 2019 50 days
eluniverso.com eluniverso.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
elwoodpanthers.net elwoodpanthers.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 7 days
epochtimes.de epochtimes.de
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 55 days
eshsathletics.com eshsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 66 days
esologs.com esologs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
espn1420.com espn1420.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
espn935.com espn935.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
espn991.com espn991.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
estevanminorhockey.com estevanminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Oct 2019 66 days
evanstonathletics.com evanstonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
examinedexistence.com examinedexistence.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
fadeawayworld.net fadeawayworld.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
fansided.com fansided.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
fcgriffins.com fcgriffins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
feedclub.com.br feedclub.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 5 days
fentonathletics.org fentonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 65 days
fextralife.com fextralife.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 65 days
fightingeaglesports.org fightingeaglesports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
fightinggobbler.com fightinggobbler.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
fikeathletics.com fikeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
filerathletics.com filerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 64 days
flywareagle.com flywareagle.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
fnsflagfootball.ca fnsflagfootball.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 53 days
folsomathletics.com folsomathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 4 days
foodsided.com foodsided.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 81 days
footballoutsiders.com footballoutsiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
footballscoop.com footballscoop.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
fourfourcrew.com fourfourcrew.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 53 days
frankenmuthathletics.com frankenmuthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
funbrk.com funbrk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 155 days
funsubstance.com funsubstance.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
futboltotal.com.mx futboltotal.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 4 days
fvhsathletics.com fvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
gadsdencityathletics.com gadsdencityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gaffneyindiansathletics.com gaffneyindiansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gagadaily.com gagadaily.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
gamespew.com gamespew.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 58 days
gametimect.com gametimect.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
garawayathletics.com garawayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
gatesheadanddistrictsundayleague.co.uk gatesheadanddistrictsundayleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
gazettes.com gazettes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 48 days
gcshawks.com gcshawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
gestiopolis.com gestiopolis.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 49 days
gizbot.com gizbot.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
gjhstigers.com gjhstigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
glacierpilots.com glacierpilots.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
gnashockey.com gnashockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Jun 2019 One Off
goadamscentralathletics.com goadamscentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goaledobearcats.com goaledobearcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
gobeavertonbeavers.com gobeavertonbeavers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 2 days
gobigredknox.com gobigredknox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 2 days
goblackshirts.com goblackshirts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gocardinalritter.org gocardinalritter.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gocelts.com gocelts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gocentralsports.com gocentralsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goclementsfootball.com goclementsfootball.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goclspartans.org goclspartans.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
godinezathletics.com godinezathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 2 days
goeasterneagles.org goeasterneagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gofalconathletics.com gofalconathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gofalconsports.org gofalconsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goganders.com goganders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gohammondathletics.com gohammondathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goheritage.org goheritage.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gohhshurricanes.com gohhshurricanes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gohowebulldogs.net gohowebulldogs.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gokennedycavs.com gokennedycavs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gomaroonsathletics.com gomaroonsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gonorthridgevikings.com gonorthridgevikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goplymouthathletics.com goplymouthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gorajahs.com gorajahs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gorebelsathletics.com gorebelsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goriversideathletics.com goriversideathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gosabercatsgo.com gosabercatsgo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
goscarboroughspartans.com goscarboroughspartans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
govikingsathletics.com govikingsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gowbmillers.com gowbmillers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
gowildcatactivities.com gowildcatactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
greatheartsirvingathletics.org greatheartsirvingathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
groceryshopforfree.com groceryshopforfree.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 56 days
grubstreet.com grubstreet.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
guiadelnino.com guiadelnino.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Oct 2019 62 days
guiadelocio.com guiadelocio.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 159 days
guiamicasamiento.com guiamicasamiento.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
guiaturista.com.mx guiaturista.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
gwcarversports.com gwcarversports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hadd.world hadd.world
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
haftrhawks.com haftrhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hailvarsity.com hailvarsity.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 55 days
hancinema.net hancinema.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Oct 2019 26 days
hcaeaglessports.org hcaeaglessports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hcbeavers.net hcbeavers.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
helloallen.com helloallen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloames.com helloames.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloapex.com helloapex.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobainbridgeisland.com hellobainbridgeisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Mar 2014 2 years, 14 days
hellobaker.com hellobaker.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloballwin.com helloballwin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobarberton.com hellobarberton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobattleground.com hellobattleground.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
hellobeloit.com hellobeloit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloberkeley.com helloberkeley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobethany.com hellobethany.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobeverly.com hellobeverly.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobourbonnais.com hellobourbonnais.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobradford.com hellobradford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloburnsville.com helloburnsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellobutte.com hellobutte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellocanberra.com hellocanberra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellochaska.com hellochaska.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellocleburne.com hellocleburne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Jun 2014 2 years, 105 days
helloclifton.com helloclifton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloclinton.com helloclinton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocuyahogafalls.com hellocuyahogafalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2014 2 years, 224 days
hellodakar.com hellodakar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellodarwin.com hellodarwin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Mar 2016 4 years, 31 days
hellodickinson.com hellodickinson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellodowney.com hellodowney.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellodraper.com hellodraper.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloearth.com helloearth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-121239807 May 2019 Oct 2019 159 days
helloelizabeth.com helloelizabeth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellofairviewheights.com hellofairviewheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellofarragut.com hellofarragut.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellogiza.com hellogiza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellogladstone.com hellogladstone.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellogodfrey.com hellogodfrey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogoosecreek.com hellogoosecreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellogrenadines.com hellogrenadines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohampton.com hellohampton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloharkerheights.com helloharkerheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Jul 2014 2 years, 133 days
hellohastings.com hellohastings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellohenderson.com hellohenderson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Mar 2016 4 years, 31 days
hellohobbs.com hellohobbs.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 Oct 2013 One Off
hellohudson.com hellohudson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Dec 2012 Dec 2013 364 days
helloirving.com helloirving.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellojos.com hellojos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellojurupavalley.com hellojurupavalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolacanadaflintridge.com hellolacanadaflintridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellolakewood.com hellolakewood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellolanghorne.com hellolanghorne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloleaguecity.com helloleaguecity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolewisville.com hellolewisville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomadras.com hellomadras.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomaricopa.com hellomaricopa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomarrakech.com hellomarrakech.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomarshall.com hellomarshall.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomassapequapark.com hellomassapequapark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Feb 2012 One Off
hellomayfieldheights.com hellomayfieldheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Jul 2014 2 years, 133 days
hellomckeesport.com hellomckeesport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomckinney.com hellomckinney.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomelrosepark.com hellomelrosepark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomendotaheights.com hellomendotaheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomenomoneefalls.com hellomenomoneefalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomiamisburg.com hellomiamisburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomiddle.com hellomiddle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomissionviejo.com hellomissionviejo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomoline.com hellomoline.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellomonroe.com hellomonroe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellonapavalley.com hellonapavalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonationalcity.com hellonationalcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonewiberia.com hellonewiberia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellooaklawnvillage.com hellooaklawnvillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooceanside.com hellooceanside.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloolivebranch.com helloolivebranch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellopaducah.com hellopaducah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellopocatello.com hellopocatello.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellopontiac.com hellopontiac.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloportsainttlucie.com helloportsainttlucie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportsmouth.com helloportsmouth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloprescott.com helloprescott.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloroundlakebeach.com helloroundlakebeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellorwanda.com hellorwanda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosantapaula.com hellosantapaula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosantee.com hellosantee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloschaumburg.com helloschaumburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Mar 2014 2 years, 14 days
helloschenectady.com helloschenectady.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosheffield.com hellosheffield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
helloshenyang.com helloshenyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
helloshorewood.com helloshorewood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosofia.com hellosofia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosouthmilwaukee.com hellosouthmilwaukee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellosparks.com hellosparks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellotuscaloosa.com hellotuscaloosa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellounion.com hellounion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellovincennes.com hellovincennes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowarnerrobins.com hellowarnerrobins.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowarren.com hellowarren.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 May 2016 4 years, 80 days
hellowashington.com hellowashington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowestmemphis.com hellowestmemphis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowestsacramento.com hellowestsacramento.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowhitewater.com hellowhitewater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowintergarden.com hellowintergarden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellowoodbridge.com hellowoodbridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellowyoming.com hellowyoming.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloyolo.com helloyolo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hellozanesville.com hellozanesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Feb 2012 Oct 2013 1 year, 236 days
hertsadvertisersundayfl.co.uk hertsadvertisersundayfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
hhcardinals.com hhcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hhcomets.com hhcomets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
hhshawksnest.com hhshawksnest.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hhsmustangathletics.org hhsmustangathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
hibernian-mad.co.uk hibernian-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
hilandathletics.com hilandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hillgroveathletics.com hillgroveathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hockeyfights.com hockeyfights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
hopkinsathletics.com hopkinsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
horizonprimarype.com horizonprimarype.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 158 days
hot1073jamz.com hot1073jamz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
houndnation1.com houndnation1.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
howemilitaryathletics.org howemilitaryathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
howlinhockey.com howlinhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
hseroyalsathletics.com hseroyalsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hwhswildcats.com hwhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
hzxtjdz.com hzxtjdz.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
iheartcats.com iheartcats.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
ilateral.com ilateral.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 157 days
illianachristianvikings.com illianachristianvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 59 days
imagenradio.com.mx imagenradio.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 96 days
imp.center imp.center
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 109 days
insidehoops.com insidehoops.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
iwkprohockeydraft.com iwkprohockeydraft.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 108 days
izismile.com izismile.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
jacketathletics.com jacketathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 58 days
jantakiawaz.org jantakiawaz.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 57 days
jcpatriotsathletics.com jcpatriotsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
jellyz.live jellyz.live
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
jeromeathletics.net jeromeathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
jfoot1969.co.uk jfoot1969.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
jimtownathletics.org jimtownathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
johnadamsathletics.com johnadamsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
johnmarshallathletics.org johnmarshallathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 57 days
joshuaathletics.com joshuaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
jrvikingssoftball.com jrvikingssoftball.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Jun 2019 47 days
juabwasps.com juabwasps.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 56 days
justblogbaby.com justblogbaby.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
katsfm.com katsfm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
kdat.com kdat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
keenanraiders.com keenanraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
keepingitheel.com keepingitheel.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
kentvalleyjfl.co.uk kentvalleyjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 153 days
keynshamhockeyleague.org.uk keynshamhockeyleague.org.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
kffirebirds.com kffirebirds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 55 days
kicks1055.com kicks1055.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
killerfrogs.com killerfrogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 130 days
kilmarnock-mad.co.uk kilmarnock-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 45 days
king-mag.com king-mag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
king5.com king5.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 153 days
kisscasper.com kisscasper.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
kmlchargers.com kmlchargers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 55 days
knightspride.com knightspride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 55 days
ndhsbulldogathletics.com ndhsbulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
ndhsrebels.com ndhsrebels.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
kool965.com kool965.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
krna.com krna.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
kushnercobras.com kushnercobras.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
laacibnet.net laacibnet.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
lapelathletics.com lapelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
lasportshub.com lasportshub.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
lavilleathletics.com lavilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 54 days
leedsunited-mad.co.uk leedsunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 Jun 2019 Aug 2019 43 days
leoboivinshowcase.ca leoboivinshowcase.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
livingmgz.com livingmgz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 103 days
ljvikings.com ljvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
lmshs-lions.com lmshs-lions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
loadoutroom.com loadoutroom.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
lobonation.com lobonation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
logancountyathletics.com logancountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
logangrizzlies.org logangrizzlies.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 53 days
looper.com looper.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Jul 2019 49 days
loopjamaica.com loopjamaica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
loopslu.com loopslu.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 52 days
losandes.com.ar losandes.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
lostandtaken.com lostandtaken.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
louisvuittonbag.net louisvuittonbag.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 52 days
lqathletics.com lqathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
lsfa.co.uk lsfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 103 days
lutheranathletics.org lutheranathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 52 days
mahshl.com mahshl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 102 days
manchesterunited-mad.co.uk manchesterunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Aug 2019 Aug 2019 One Off
maroonandwhitenation.com maroonandwhitenation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
mashed.com mashed.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jun 2019 47 days
masonbulldogsports.com masonbulldogsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
mcdonoughathletics.com mcdonoughathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mdchscrusaderathletics.com mdchscrusaderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
meadowcreekathletics.org meadowcreekathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
medcitynews.com medcitynews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 102 days
hellometro.com media1.hellometro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 Oct 2013 Oct 2013 One Off
melanieredd.com melanieredd.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 102 days
memedroid.com memedroid.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
mentertained.com mentertained.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Jul 2019 48 days
mhspolarbearathletics.com mhspolarbearathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 51 days
mid-day.com mid-day.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
midcurrent.com midcurrent.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
necbl.com necbl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 146 days
milandawgs.com milandawgs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
milehighmaniac.com milehighmaniac.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
mineralcountyminer.com mineralcountyminer.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Oct 2019 129 days
mix931fm.com mix931fm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
mlbreports.tv mlbreports.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
moblivious.com moblivious.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Sep 2019 56 days
modernmuzzleloader.com modernmuzzleloader.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Oct 2019 26 days
mommyneedsvodka.com mommyneedsvodka.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
momsrow.com momsrow.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 50 days
moonareaathletics.com moonareaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 50 days
morningjournal.com morningjournal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
moviemistakes.com moviemistakes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
mshstrojanathletics.com mshstrojanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
mtairynews.com mtairynews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Sep 2019 One Off
multiculturalyp.com multiculturalyp.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-350746 May 2012 May 2016 3 years, 364 days
mvmavericks.com mvmavericks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
mvwildcats.com mvwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 49 days
mydallaspost.com mydallaspost.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 May 2019 One Off
myha.org myha.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 49 days
mytinschi.de mytinschi.de
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Oct 2019 147 days
nbaanalysis.net nbaanalysis.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 146 days
nbagamesim.com nbagamesim.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
nbgha.com nbgha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 48 days
news-herald.com news-herald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
newstalk870.am newstalk870.am
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
newsy.com newsy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 47 days
nextstephockey.com nextstephockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
nmblacktornadosports.com nmblacktornadosports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 48 days
northviewsports.com northviewsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
nshahsathletics.com nshahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
nutleyathletics.org nutleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
nybeachcams.com nybeachcams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 98 days
ocoeeathletics.com ocoeeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
odcsathletics.org odcsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
odemowlathletics.com odemowlathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
ohspiratesathletics.com ohspiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
oilonwhyte.com oilonwhyte.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
okemosathletics.net okemosathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
oldielyrics.com oldielyrics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
olentangylibertyathletics.com olentangylibertyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 47 days
olneycharterathletics.com olneycharterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
olympiahighschoolathletics.com olympiahighschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
onvideo.org onvideo.org
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
ooyyo.com ooyyo.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 46 days
orovillemr.com orovillemr.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
osseo-orioles.com osseo-orioles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
otroligtbra.se otroligtbra.se
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
ourlads.com ourlads.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 130 days
ovidelsiesports.com ovidelsiesports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 46 days
paradisepost.com paradisepost.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
passaicvalleyathletics.com passaicvalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pchsathletics.com pchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pcrecordtimes.com pcrecordtimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Sep 2019 104 days
pebblebrookathletics.com pebblebrookathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pembinavalleymha.com pembinavalleymha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Oct 2019 45 days
pembrokeshireleague.co.uk pembrokeshireleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 48 days
pflsports.net pflsports.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
phimso1.us phimso1.us
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 16 days
phlaleagues.ca phlaleagues.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
phsbulldogsathletics.org phsbulldogsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pikecentralathletics.com pikecentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pikeroadathletics.org pikeroadathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pinckneypiratesathletics.com pinckneypiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 45 days
pistonpowered.com pistonpowered.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
plattepirates.org plattepirates.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 81 days
pleasantonathletics.com pleasantonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
pmawarriorsathletics.com pmawarriorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
poe.trade poe.trade
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 143 days
poetsathletics.com poetsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
poresto.net poresto.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 81 days
pottershousepumas.com pottershousepumas.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
powdersvillepatriotathletics.com powdersvillepatriotathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
predominantlyorange.com predominantlyorange.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 82 days
prhslions.com prhslions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 44 days
primiciasya.com primiciasya.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 Jul 2019 48 days
priuschat.com priuschat.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
prosportsdaily.com prosportsdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Oct 2019 82 days
pucksofafeather.com pucksofafeather.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
purcellmarianathletics.org purcellmarianathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
pvathletics.com pvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
pvhsathletics.com pvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
pwpodcasts.com pwpodcasts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 142 days
qmusica.tv qmusica.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Oct 2019 95 days
queensparkrangers-mad.co.uk queensparkrangers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 34 days
radio.com radio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
radiopup.com radiopup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
randolphathletics.net randolphathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
rattlernationathletics.com rattlernationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
ravennaathletics.us ravennaathletics.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
ravennabulldogsathletics.com ravennabulldogsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 43 days
rcunited.ca rcunited.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Aug 2019 52 days
readersdigest.ca readersdigest.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
rebootplatform.info rebootplatform.info
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
redanhighathletics.com redanhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
redrants.com redrants.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Oct 2019 26 days
reeths-pufferathletics.com reeths-pufferathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
referatele.com referatele.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 42 days
reporterherald.com reporterherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
rhymejunkie.com rhymejunkie.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
riflehighschoolsports.com riflehighschoolsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 42 days
rihannasnavy.com rihannasnavy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 80 days
rinkroyalty.com rinkroyalty.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jun 2019 Oct 2019 130 days
ripbladehockeyeast.com ripbladehockeyeast.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
rivergrandrapids.com rivergrandrapids.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jul 2019 Jul 2019 One Off
HELLOQUEENSTOWN.COM
Non IP Attributes
Attribute First Last
UA UA-350746 Feb 2012 May 2016
UA UA-118163407 Aug 2018 Jan 2021
GTM GTM-UA-118129358-1 May 2019 Jan 2021
UA UA-118129358 Jun 2021 Sep 2022
GTM GTM-AW-804755169 Sep 2018 Aug 2019
UA UA-121239807 May 2019 Oct 2019
GTM GTM-UA-121239807-2 May 2019 Oct 2019
CA CA-PUB-8425488243879801 May 2019 Oct 2019
DM DM-101492 May 2019 Oct 2019
SVRN SVRN-265277 May 2019 Oct 2019
SVRN SVRN-261774 May 2019 Oct 2019
LIJI LIJI-265277 May 2019 Oct 2019
ORC ORC-963 May 2019 Oct 2019
AOL AOL-6748 May 2019 Oct 2019
AOL AOL-6614 May 2019 Oct 2019
FWHL FWHL-762769 May 2019 Oct 2019
TREM TREM-J54V6-5C8FF May 2019 Oct 2019
MEDI MEDI-8CU7QPX3O May 2019 Oct 2019
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019
CONN CONN-102738 May 2019 Oct 2019
SONO SONO-783272317B May 2019 Oct 2019
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019
DM DM-100974 May 2019 Aug 2019
NEX NEX-3391 May 2019 Aug 2019
ORC ORC-402 May 2019 Aug 2019
FWHL FWHL-762737 May 2019 Aug 2019
TEAD TEAD-16544 Aug 2019 Oct 2019
AOL AOL-11647 Aug 2019 Oct 2019
FWHL FWHL-970193 Aug 2019 Oct 2019
IEX IEX-189205 Aug 2019 Oct 2019
TELA TELA-457 Aug 2019 Oct 2019
AVVID AVVID-7802 Aug 2019 Oct 2019
YUME YUME-4016333178 Aug 2019 Oct 2019
PUBM PUBM-158017 Aug 2019 Oct 2019
GUMG GUMG-13810 Aug 2019 Oct 2019
PRIM PRIM-19139 Aug 2019 Oct 2019
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018
CA CA-PUB-9695858187321950 Aug 2018 Sep 2018
LIJI LIJI-261774 Aug 2019 Aug 2019
AOL AOL-49648 Aug 2019 Aug 2019
CA CA-PUB-5369125237996028 Oct 2019 Oct 2019
HELLOQUEENSTOWN.COM
Overlap Attribute Domains
helloqueenstown.com helloqueenstown.com
hellosouthsioux.com hellosouthsioux.com
hellonatchez.com hellonatchez.com
helloportsaid.com helloportsaid.com
helloquebec.com helloquebec.com
hellofez.com hellofez.com
hellomanagua.com hellomanagua.com
hellomountainview.com hellomountainview.com
helloshoreview.com helloshoreview.com
hellombuji-mayi.com hellombuji-mayi.com
hellostockholm.com hellostockholm.com
hellotolyatti.com hellotolyatti.com
hellococoa.com hellococoa.com
hellojamestown.com hellojamestown.com
hellolucern.com hellolucern.com
hellomaseru.com hellomaseru.com
hellonorfolk.com hellonorfolk.com
helloflagstaff.com helloflagstaff.com
hellohalifax.com hellohalifax.com
hellomiddletown.com hellomiddletown.com
hellonagoya.com hellonagoya.com
hellonorwalk.com hellonorwalk.com
hellosuffolk.com hellosuffolk.com
hellozibo.com hellozibo.com
hellojohnstown.com hellojohnstown.com
hellomadrid.com hellomadrid.com
helloyoungstown.com helloyoungstown.com
hellofreetown.com hellofreetown.com
hellogilberttown.com hellogilberttown.com
helloluzern.com helloluzern.com
hellomoundsview.com hellomoundsview.com
hellomukilteo.com hellomukilteo.com
hellonewyorkcity.com hellonewyorkcity.com
hellonovosibirsk.com hellonovosibirsk.com
helloradcliff.com helloradcliff.com
helloraytown.com helloraytown.com
hellosamoa.com hellosamoa.com
hellobethlehem.com hellobethlehem.com
hellodoylestown.com hellodoylestown.com
hellomacomb.com hellomacomb.com
helloperu.com helloperu.com
helloplainview.com helloplainview.com
hellosaintjohn.com hellosaintjohn.com
hellosalem.com hellosalem.com
hellosanmateo.com hellosanmateo.com
hellotahlequah.com hellotahlequah.com
hellowoodburn.com hellowoodburn.com
helloyazoo.com helloyazoo.com
hellobengaluru.com hellobengaluru.com
hellogenoa.com hellogenoa.com
hellomaranatown.com hellomaranatown.com
hellomenasha.com hellomenasha.com
helloomaha.com helloomaha.com
helloorem.com helloorem.com
helloqingdao.com helloqingdao.com
hellosandusky.com hellosandusky.com
hellothibodaux.com hellothibodaux.com
hellozaporizhzhya.com hellozaporizhzhya.com
helloeastchicago.com helloeastchicago.com
hellolittleelm.com hellolittleelm.com
hellonewulm.com hellonewulm.com
hellonorristown.com hellonorristown.com
hellopoplarbluff.com hellopoplarbluff.com
hellosavannah.com hellosavannah.com
helloantigua.com helloantigua.com
helloaruba.com helloaruba.com
helloelk.com helloelk.com
hellograndview.com hellograndview.com
hellotamarac.com hellotamarac.com
hellotaraz.com hellotaraz.com
helloallentown.com helloallentown.com
hellograz.com hellograz.com
helloizhevsk.com helloizhevsk.com
helloottawa.com helloottawa.com
hellosantafa.com hellosantafa.com
hellotahiti.com hellotahiti.com
helloallouez.com helloallouez.com
hellobardstown.com hellobardstown.com
hellomalabo.com hellomalabo.com
hellonanaimo.com hellonanaimo.com
helloneenah.com helloneenah.com
helloparamaribo.com helloparamaribo.com
helloschertz.com helloschertz.com
hellowindhoek.com hellowindhoek.com
hellogaziantep.com hellogaziantep.com
hellohaiti.com hellohaiti.com
hellolodz.com hellolodz.com
hellominneapolis.com hellominneapolis.com
hellooakcreek.com hellooakcreek.com
hellooconomowoc.com hellooconomowoc.com
hellopiqua.com hellopiqua.com
hellosaintpaul.com hellosaintpaul.com
hellosanaa.com hellosanaa.com
helloscottsbluff.com helloscottsbluff.com
hellosioux.com hellosioux.com
hellotokyo.com hellotokyo.com
hellocuracao.com hellocuracao.com
hellodavao.com hellodavao.com
hellokalamazoo.com hellokalamazoo.com
hellolodi.com hellolodi.com
hellomoroni.com hellomoroni.com
hellonicaragua.com hellonicaragua.com
hellopeterborough.com hellopeterborough.com
helloqueencreek.com helloqueencreek.com
helloutah.com helloutah.com
hellowalnutcreek.com hellowalnutcreek.com
helloadisabeba.com helloadisabeba.com
hellocorpuschristi.com hellocorpuschristi.com
helloglenview.com helloglenview.com
hellojacksonville.com hellojacksonville.com
hellotaunggyi.com hellotaunggyi.com
hellococonutcreek.com hellococonutcreek.com
hellohuntsville.com hellohuntsville.com
hellomalibu.com hellomalibu.com
hellothimphu.com hellothimphu.com
hellowinston-salem.com hellowinston-salem.com
helloalexandriaegypt.com helloalexandriaegypt.com
hellobiloxi.com hellobiloxi.com
helloblackfoot.com helloblackfoot.com
hellofaribault.com hellofaribault.com
helloidaho.com helloidaho.com
hellopinebluff.com hellopinebluff.com
hellosantaclara.com hellosantaclara.com
hellobattlecreek.com hellobattlecreek.com
helloguelph.com helloguelph.com
hellomanitowoc.com hellomanitowoc.com
hellosouthlaketahoe.com hellosouthlaketahoe.com
hellotaipei.com hellotaipei.com
hellowinnipeg.com hellowinnipeg.com
hellocuba.com hellocuba.com
hellodavenport.com hellodavenport.com
hellofortaleza.com hellofortaleza.com
helloshanghai.com helloshanghai.com
helloaddisababa.com helloaddisababa.com
hellobelleview.com hellobelleview.com
hellochicago.com hellochicago.com
hellomccomb.com hellomccomb.com
hellomississippi.com hellomississippi.com
helloriorancho.com helloriorancho.com
hellosaratov.com hellosaratov.com
helloalsip.com helloalsip.com
hellobuckeyetown.com hellobuckeyetown.com
hellocolumbia.com hellocolumbia.com
hellocolumbus.com hellocolumbus.com
hellolaketahoe.com hellolaketahoe.com
hellolincoln.com hellolincoln.com
hellonewburgh.com hellonewburgh.com
hellonewlenox.com hellonewlenox.com
helloraleigh.com helloraleigh.com
hellosaintpetersburg.com hellosaintpetersburg.com
hellosanluisobispo.com hellosanluisobispo.com
hellosiemreap.com hellosiemreap.com
helloantwerp.com helloantwerp.com
helloarlingtontx.com helloarlingtontx.com
hellobaytown.com hellobaytown.com
hellochicopee.com hellochicopee.com
hellocouncilbluffs.com hellocouncilbluffs.com
hellodekalb.com hellodekalb.com
hellolilongwe.com hellolilongwe.com
hellomogadishu.com hellomogadishu.com
hellonixa.com hellonixa.com
helloprovo.com helloprovo.com
hellowaterloo.com hellowaterloo.com
helloajax.com helloajax.com
helloconnecticut.com helloconnecticut.com
hellolenexa.com hellolenexa.com
helloplumborough.com helloplumborough.com
helloanaheim.com helloanaheim.com
hellohochiminh.com hellohochiminh.com
helloirmo.com helloirmo.com
helloistanbul.com helloistanbul.com
hellomerced.com hellomerced.com
hellosacramento.com hellosacramento.com
hellostjohn.com hellostjohn.com
hellofonddulac.com hellofonddulac.com
hellojaffa.com hellojaffa.com
hellopasadena.com hellopasadena.com
hellosantacruz.com hellosantacruz.com
helloabuja.com helloabuja.com
helloantananarivo.com helloantananarivo.com
hellobemidji.com hellobemidji.com
hellochattanooga.com hellochattanooga.com
hellodc.com hellodc.com
hellohialeah.com hellohialeah.com
hellohonolulu.com hellohonolulu.com
hellokentucky.com hellokentucky.com
helloberwyn.com helloberwyn.com
hellogaza.com hellogaza.com
hellolibya.com hellolibya.com
hellospokane.com hellospokane.com
hellodearborn.com hellodearborn.com
hellofuzhou.com hellofuzhou.com
hellogurnee.com hellogurnee.com
hellonewdelhi.com hellonewdelhi.com
hellounionnj.com hellounionnj.com
helloalisoviejo.com helloalisoviejo.com
hellonorthmiami.com hellonorthmiami.com
hellooahu.com hellooahu.com
hellosaintlouis.com hellosaintlouis.com
hellovaduz.com hellovaduz.com
hellocharleston.com hellocharleston.com
hellocrestview.com hellocrestview.com
hellofortbragg.com hellofortbragg.com
hellogalt.com hellogalt.com
helloouagadougou.com helloouagadougou.com
hellooshawa.com hellooshawa.com
hellophiladelphia.com hellophiladelphia.com
hellochickasha.com hellochickasha.com
hellopittsburgh.com hellopittsburgh.com
hellosuisun.com hellosuisun.com
hellomaiduguri.com hellomaiduguri.com
helloroyaloak.com helloroyaloak.com
hellowashingtondc.com hellowashingtondc.com
helloenumclaw.com helloenumclaw.com
hellosantabarbara.com hellosantabarbara.com
hellosunnyvale.com hellosunnyvale.com
helloaleppo.com helloaleppo.com
hellohawaii.com hellohawaii.com
hellotelaviv.com hellotelaviv.com
hellolouisville.com hellolouisville.com
hellobellevue.com hellobellevue.com
hellobronx.com hellobronx.com
hellocoalinga.com hellocoalinga.com
hellomilwaukee.com hellomilwaukee.com
hellosoutheuclid.com hellosoutheuclid.com
hellotabriz.com hellotabriz.com
hellomcdonough.com hellomcdonough.com
hellomillbrae.com hellomillbrae.com
hellovoronezh.com hellovoronezh.com
helloakron.com helloakron.com
helloboise.com helloboise.com
helloenid.com helloenid.com
hellomontgomery.com hellomontgomery.com
hellolatrobe.com hellolatrobe.com
hellolehi.com hellolehi.com
hellotoledo.com hellotoledo.com
hellomarlborough.com hellomarlborough.com
hellomaui.com hellomaui.com
hellosarajevo.com hellosarajevo.com
hellocanton.com hellocanton.com
hellogalveston.com hellogalveston.com
hellomanhattan.com hellomanhattan.com
hellocincinnati.com hellocincinnati.com
hellosaltlakecity.com hellosaltlakecity.com
hellosarasota.com hellosarasota.com
hellobirmingham.com hellobirmingham.com
hellobountiful.com hellobountiful.com
helloreno.com helloreno.com
helloelko.com helloelko.com
hellosyracuse.com hellosyracuse.com
helloderby.com helloderby.com
helloalbuquerque.com helloalbuquerque.com
hellohamptonroads.com hellohamptonroads.com
hellomiami.com hellomiami.com
helloglenellyn.com helloglenellyn.com
hellonairobi.com hellonairobi.com
helloquanzhou.com helloquanzhou.com
helloshantou.com helloshantou.com
hellosoho.com hellosoho.com
helloperm.com helloperm.com
hellonouakchott.com hellonouakchott.com
hellosaintbarthelemy.com hellosaintbarthelemy.com
helloalaska.com helloalaska.com
helloiowa.com helloiowa.com
hellodinuba.com hellodinuba.com
hellopharr.com hellopharr.com
hellochambersburgborough.com hellochambersburgborough.com
hellohelsinki.com hellohelsinki.com
hellogeneva.com hellogeneva.com
hellokennesaw.com hellokennesaw.com
hellobishkek.com hellobishkek.com
hellochelyabinsk.com hellochelyabinsk.com
hellovitebsk.com hellovitebsk.com
helloaligarh.com helloaligarh.com
hellokaduna.com hellokaduna.com
hellokobe.com hellokobe.com
helloliuzhou.com helloliuzhou.com
hellotomsk.com hellotomsk.com
hellobari.com hellobari.com
hellodonetsk.com hellodonetsk.com
hellobilbao.com hellobilbao.com
hellobozhou.com hellobozhou.com
hellobrno.com hellobrno.com
hellobryansk.com hellobryansk.com
hellocotonou.com hellocotonou.com
helloguangzhou.com helloguangzhou.com
helloirkutsk.com helloirkutsk.com
hellorugao.com hellorugao.com
helloulyanovsk.com helloulyanovsk.com
helloyichun.com helloyichun.com
helloblagoveshchensk.com helloblagoveshchensk.com
hellocantho.com hellocantho.com
hellohezhou.com hellohezhou.com
hellokryvyirih.com hellokryvyirih.com
hellorizhao.com hellorizhao.com
theweek.com theweek.com
dexerto.fr dexerto.fr
hellobamako.com hellobamako.com
hellobarcelona.com hellobarcelona.com
hellobristol.com hellobristol.com
hellobrussels.com hellobrussels.com
hellobudapest.com hellobudapest.com
helloconakry.com helloconakry.com
hellocopenhagen.com hellocopenhagen.com
hellocorinth.com hellocorinth.com
hellocostarica.com hellocostarica.com
helloharbin.com helloharbin.com
helloilorin.com helloilorin.com
helloindonesia.com helloindonesia.com
helloinnsbruck.com helloinnsbruck.com
hellokaragandy.com hellokaragandy.com
hellokatowice.com hellokatowice.com
hellokhabarovsk.com hellokhabarovsk.com
hellokinshasa.com hellokinshasa.com
hellokoln.com hellokoln.com
helloluanda.com helloluanda.com
hellolubumbashi.com hellolubumbashi.com
hellolugansk.com hellolugansk.com
hellomunster.com hellomunster.com
hellonuremberg.com hellonuremberg.com
helloparis.com helloparis.com
hellophilippines.com hellophilippines.com
helloportoalegre.com helloportoalegre.com
helloprague.com helloprague.com
hellopuertovallarta.com hellopuertovallarta.com
hellopusan.com hellopusan.com
hellorabat.com hellorabat.com
helloreykjavik.com helloreykjavik.com
hellorybinsk.com hellorybinsk.com
hellostrasbourg.com hellostrasbourg.com
hellothunderbay.com hellothunderbay.com
hellotoronto.com hellotoronto.com
hellotripoli.com hellotripoli.com
dexerto.com dexerto.com
floridatravellife.com floridatravellife.com
helloabidjan.com helloabidjan.com
hellobards.com hellobards.com
hellobelarus.com hellobelarus.com
hellobogota.com hellobogota.com
hellobordeaux.com hellobordeaux.com
hellobrantford.com hellobrantford.com
hellobrisbane.com hellobrisbane.com
hellocairo.com hellocairo.com
hellochangchun.com hellochangchun.com
hellochangsha.com hellochangsha.com
hellochristchurch.com hellochristchurch.com
helloguatemalacity.com helloguatemalacity.com
hellohamburg.com hellohamburg.com
hellohuzhou.com hellohuzhou.com
hellokolwezi.com hellokolwezi.com
hellokyoto.com hellokyoto.com
hellolinz.com hellolinz.com
hellolusaka.com hellolusaka.com
hellomainz.com hellomainz.com
hellomontreal.com hellomontreal.com
helloosaka.com helloosaka.com
hellorajkot.com hellorajkot.com
helloastana.com helloastana.com
helloaustria.com helloaustria.com
hellobremen.com hellobremen.com
hellobuenosaires.com hellobuenosaires.com
hellocapetown.com hellocapetown.com
hellocasablanca.com hellocasablanca.com
hellodouala.com hellodouala.com
hellodusseldorf.com hellodusseldorf.com
helloedinburg.com helloedinburg.com
helloglasgow.com helloglasgow.com
hellohamadtown.com hellohamadtown.com
hellojakarta.com hellojakarta.com
hellokiel.com hellokiel.com
hellolapaz.com hellolapaz.com
helloliverpool.com helloliverpool.com
hellomaputo.com hellomaputo.com
hellomilan.com hellomilan.com
hellomonterrey.com hellomonterrey.com
helloportharcourt.com helloportharcourt.com
hellosalzburg.com hellosalzburg.com
hellosapporo.com hellosapporo.com
hellotoulouse.com hellotoulouse.com
hellovenice.com hellovenice.com
helloyaounde.com helloyaounde.com
motorcyclecruiser.com motorcyclecruiser.com
puckermob.com puckermob.com
hellobenghazi.com hellobenghazi.com
hellobrasov.com hellobrasov.com
hellobucharest.com hellobucharest.com
hellocologne.com hellocologne.com
hellocordoba.com hellocordoba.com
helloessen.com helloessen.com
helloflorence.com helloflorence.com
helloheidelberg.com helloheidelberg.com
hellohuazhou.com hellohuazhou.com
hellojohannesburg.com hellojohannesburg.com
hellokanpur.com hellokanpur.com
hellokitchener.com hellokitchener.com
hellokrasnoyarsk.com hellokrasnoyarsk.com
hellolahore.com hellolahore.com
hellolipetsk.com hellolipetsk.com
hellomagnitogorsk.com hellomagnitogorsk.com
hellomelbourne.com hellomelbourne.com
hellomexicocity.com hellomexicocity.com
hellomontecarlo.com hellomontecarlo.com
hellomoscow.com hellomoscow.com
hellomurmansk.com hellomurmansk.com
hellooslo.com hellooslo.com
helloperth.com helloperth.com
hellorio.com hellorio.com
helloriodejaneiro.com helloriodejaneiro.com
hellosaguenay.com hellosaguenay.com
hellosalvador.com hellosalvador.com
hellosantiago.com hellosantiago.com
hellosydney.com hellosydney.com
hellotakhmau.com hellotakhmau.com
hellovancouver.com hellovancouver.com
hellovictoria.com hellovictoria.com
hellozurich.com hellozurich.com
atvrider.com atvrider.com
baseballessential.com baseballessential.com
boatingmag.com boatingmag.com
cyclevolta.com cyclevolta.com
dailydot.com dailydot.com
dexerto.es dexerto.es
flyingmag.com flyingmag.com
helloalbertlea.com helloalbertlea.com
helloalgiers.com helloalgiers.com
hellobaotou.com hellobaotou.com
hellobarquisimeto.com hellobarquisimeto.com
hellobelem.com hellobelem.com
hellobursa.com hellobursa.com
hellocebucity.com hellocebucity.com
hellochangzhou.com hellochangzhou.com
helloclujnapoca.com helloclujnapoca.com
hellodammam.com hellodammam.com
hellodresden.com hellodresden.com
helloecatepec.com helloecatepec.com
helloezhou.com helloezhou.com
hellogaozhou.com hellogaozhou.com
hellogomel.com hellogomel.com
hellogreatersudbury.com hellogreatersudbury.com
hellogreatfalls.com hellogreatfalls.com
hellohonduras.com hellohonduras.com
helloidahofalls.com helloidahofalls.com
hellojeffersonville.com hellojeffersonville.com
hellojoliet.com hellojoliet.com
hellokabul.com hellokabul.com
hellokaliningrad.com hellokaliningrad.com
hellokhartoum.com hellokhartoum.com
hellokirov.com hellokirov.com
hellokitakyushu.com hellokitakyushu.com
hellokitwe.com hellokitwe.com
hellolaplata.com hellolaplata.com
helloluzhou.com helloluzhou.com
hellomagdeburg.com hellomagdeburg.com
hellomalmo.com hellomalmo.com
hellomanama.com hellomanama.com
hellomanaus.com hellomanaus.com
hellomedicinehat.com hellomedicinehat.com
hellomosul.com hellomosul.com
hellomountjuliet.com hellomountjuliet.com
hellonovaiguacu.com hellonovaiguacu.com
helloopelousas.com helloopelousas.com
helloorenburg.com helloorenburg.com
hellopalikir.com hellopalikir.com
hellopostfalls.com hellopostfalls.com
hellorochesterhills.com hellorochesterhills.com
hellosansalvador.com hellosansalvador.com
hellotegucigalpa.com hellotegucigalpa.com
helloteheran.com helloteheran.com
hellotengzhou.com hellotengzhou.com
hellotientsin.com hellotientsin.com
helloturin.com helloturin.com
hellovalletta.com hellovalletta.com
hellovarna.com hellovarna.com
hellovisakhapatnam.com hellovisakhapatnam.com
hellowoodbuffalo.com hellowoodbuffalo.com
helloxintai.com helloxintai.com
saveur.com saveur.com
shnc.co.uk shnc.co.uk
baggersmag.com baggersmag.com
workingmother.com workingmother.com
yachtingmagazine.com yachtingmagazine.com
helloaccra.com helloaccra.com
helloalmaty.com helloalmaty.com
hellobraila.com hellobraila.com
hellobucaramanga.com hellobucaramanga.com
hellocamas.com hellocamas.com
hellocampinas.com hellocampinas.com
hellociudadguayana.com hellociudadguayana.com
hellocoquitlam.com hellocoquitlam.com
hellocozumel.com hellocozumel.com
helloedina.com helloedina.com
hellofoshan.com hellofoshan.com
hellofreeport.com hellofreeport.com
hellogretna.com hellogretna.com
helloguatemala.com helloguatemala.com
hellohubli.com hellohubli.com
helloibadan.com helloibadan.com
hellojoaopessoa.com hellojoaopessoa.com
hellojuneau.com hellojuneau.com
hellokanazawa.com hellokanazawa.com
hellokano.com hellokano.com
hellokaraj.com hellokaraj.com
hellolima.com hellolima.com
hellomelekeok.com hellomelekeok.com
hellomogilev.com hellomogilev.com
hellomuscat.com hellomuscat.com
hellonewmarket.com hellonewmarket.com
hellonezahualcoyotl.com hellonezahualcoyotl.com
helloniigata.com helloniigata.com
hellopalermo.com hellopalermo.com
hellopalmettobay.com hellopalmettobay.com
helloportelizabeth.com helloportelizabeth.com
helloquito.com helloquito.com
hellorosario.com hellorosario.com
hellorotherham.com hellorotherham.com
helloshishi.com helloshishi.com
helloshizuoka.com helloshizuoka.com
hellosuzhouanhui.com hellosuzhouanhui.com
hellotaizhou.com hellotaizhou.com
hellotallinn.com hellotallinn.com
hellowakefield.com hellowakefield.com
hellowroclaw.com hellowroclaw.com
helloyekaterinburg.com helloyekaterinburg.com
hellozapopan.com hellozapopan.com
hellozhangjiakou.com hellozhangjiakou.com
mapsofworld.com mapsofworld.com
paypath.com paypath.com
scubadiving.com scubadiving.com
streetchopperweb.com streetchopperweb.com
theodysseyonline.com theodysseyonline.com
diyphotography.net diyphotography.net
helloacapulco.com helloacapulco.com
helloaltus.com helloaltus.com
helloaqaba.com helloaqaba.com
helloathens.com helloathens.com
helloatlanticcity.com helloatlanticcity.com
hellobanjul.com hellobanjul.com
hellobelgrade.com hellobelgrade.com
helloberea.com helloberea.com
helloberlin.com helloberlin.com
hellochangshu.com hellochangshu.com
hellochennai.com hellochennai.com
hellochinohills.com hellochinohills.com
hellociudadjuarez.com hellociudadjuarez.com
hellocixi.com hellocixi.com
hellocorona.com hellocorona.com
hellodavaocity.com hellodavaocity.com
hellodongtai.com hellodongtai.com
helloerdenet.com helloerdenet.com
hellofountainhills.com hellofountainhills.com
hellogatineau.com hellogatineau.com
hellogent.com hellogent.com
helloguarulhos.com helloguarulhos.com
hellohavana.com hellohavana.com
hellojixi.com hellojixi.com
hellojodhpur.com hellojodhpur.com
hellokaluga.com hellokaluga.com
hellolimerick.com hellolimerick.com
hellolubeck.com hellolubeck.com
hellomontegobay.com hellomontegobay.com
helloqiqihar.com helloqiqihar.com
hellorome.com hellorome.com
hellorostock.com hellorostock.com
hellosochi.com hellosochi.com
hellosurakarta.com hellosurakarta.com
hellotirana.com hellotirana.com
hellotoluca.com hellotoluca.com
hellovernonhills.com hellovernonhills.com
hellowichitafalls.com hellowichitafalls.com
helloxuzhou.com helloxuzhou.com
helloyaroslavl.com helloyaroslavl.com
hellozaria.com hellozaria.com
hellozhengzhou.com hellozhengzhou.com
scarymommy.com scarymommy.com
sizzlepixs.com sizzlepixs.com
wakeboardingmag.com wakeboardingmag.com
cycleworld.com cycleworld.com
denofgeek.com denofgeek.com
dgreetings.com dgreetings.com
fieldandstream.com fieldandstream.com
helloallahabad.com helloallahabad.com
hellobangui.com hellobangui.com
hellobelmopan.com hellobelmopan.com
hellobijie.com hellobijie.com
hellobissau.com hellobissau.com
hellobochum.com hellobochum.com
hellocairns.com hellocairns.com
hellocancun.com hellocancun.com
hellocedarcity.com hellocedarcity.com
hellochisinau.com hellochisinau.com
hellocolumbiaheights.com hellocolumbiaheights.com
hellodunlaoghaire.com hellodunlaoghaire.com
hellofrankfurt.com hellofrankfurt.com
hellofukuoka.com hellofukuoka.com
hellohamamatsu.com hellohamamatsu.com
hellohermosillo.com hellohermosillo.com
hellohiroshima.com hellohiroshima.com
hellohohhot.com hellohohhot.com
helloivanovo.com helloivanovo.com
hellojinzhou.com hellojinzhou.com
hellokawasaki.com hellokawasaki.com
hellokiev.com hellokiev.com
hellokrasnodar.com hellokrasnodar.com
hellokualalumpur.com hellokualalumpur.com
hellokumamoto.com hellokumamoto.com
hellolaizhou.com hellolaizhou.com
hellolasi.com hellolasi.com
hellomexicali.com hellomexicali.com
hellomirat.com hellomirat.com
hellomosspoint.com hellomosspoint.com
hellomunich.com hellomunich.com
hellonakhonratchasima.com hellonakhonratchasima.com
hellonassau.com hellonassau.com
hellonicosia.com hellonicosia.com
hellononthaburi.com hellononthaburi.com
helloogbomosho.com helloogbomosho.com
hellopaloshills.com hellopaloshills.com
hellopodgorica.com hellopodgorica.com
helloprospect.com helloprospect.com
helloquebeccity.com helloquebeccity.com
helloquezoncity.com helloquezoncity.com
helloriffa.com helloriffa.com
hellosaanich.com hellosaanich.com
hellosalinas.com hellosalinas.com
hellosanpaulo.com hellosanpaulo.com
helloseongnam.com helloseongnam.com
hellosomerset.com hellosomerset.com
hellostpetersburg.com hellostpetersburg.com
hellotongzhou.com hellotongzhou.com
hellotunis.com hellotunis.com
mapsofindia.com mapsofindia.com
popphoto.com popphoto.com
allfreecrochetafghanpatterns.com allfreecrochetafghanpatterns.com
sufcacademy.com sufcacademy.com
swellinfo.com swellinfo.com
thefader.com thefader.com
thehuddle.com thehuddle.com
twinfinite.net twinfinite.net
billboard.com billboard.com
catfish1.com catfish1.com
doityourself.com doityourself.com
ebaumsworld.com ebaumsworld.com
elections.in elections.in
fashionbeans.com fashionbeans.com
federaltimes.com federaltimes.com
fieldandstreamexpo.com fieldandstreamexpo.com
floor8.com floor8.com
fstoppers.com fstoppers.com
haccricket.org haccricket.org
helloaltoona.com helloaltoona.com
helloanchorage.com helloanchorage.com
helloannapolis.com helloannapolis.com
helloashgabat.com helloashgabat.com
helloaspen.com helloaspen.com
helloatlanta.com helloatlanta.com
helloauckland.com helloauckland.com
hellobakersfield.com hellobakersfield.com
hellobaltimore.com hellobaltimore.com
hellobarranquilla.com hellobarranquilla.com
hellobatonrouge.com hellobatonrouge.com
hellobermuda.com hellobermuda.com
hellobethesda.com hellobethesda.com
hellobloomingdale.com hellobloomingdale.com
helloboulder.com helloboulder.com
helloboyntonbeach.com helloboyntonbeach.com
hellobroomfield.com hellobroomfield.com
hellobrossard.com hellobrossard.com
hellobrownsburg.com hellobrownsburg.com
hellocapecoral.com hellocapecoral.com
hellocedarburg.com hellocedarburg.com
hellocentralpoint.com hellocentralpoint.com
hellocharleroi.com hellocharleroi.com
hellocharlotte.com hellocharlotte.com
hellochatham-kent.com hellochatham-kent.com
hellochesapeake.com hellochesapeake.com
hellocuritiba.com hellocuritiba.com
hellodamascus.com hellodamascus.com
hellodarien.com hellodarien.com
hellodeerfieldbeach.com hellodeerfieldbeach.com
hellodeerpark.com hellodeerpark.com
hellodepere.com hellodepere.com
hellodublin.com hellodublin.com
helloduluth.com helloduluth.com
helloeastmoline.com helloeastmoline.com
helloeastpoint.com helloeastpoint.com
helloeugene.com helloeugene.com
hellofargo.com hellofargo.com
hellofortwayne.com hellofortwayne.com
hellofremont.com hellofremont.com
hellofullerton.com hellofullerton.com
hellogardner.com hellogardner.com
hellogatlinburg.com hellogatlinburg.com
hellogerman.com hellogerman.com
hellogloucester.com hellogloucester.com
hellogoleta.com hellogoleta.com
hellogoodyear.com hellogoodyear.com
hellograndprairie.com hellograndprairie.com
hellogrodno.com hellogrodno.com
helloharlingen.com helloharlingen.com
hellohavelock.com hellohavelock.com
hellohuntingtonpark.com hellohuntingtonpark.com
hellojalandhar.com hellojalandhar.com
hellokeywest.com hellokeywest.com
hellolagunaniguel.com hellolagunaniguel.com
hellolamirada.com hellolamirada.com
hellolaredo.com hellolaredo.com
hellolinolakes.com hellolinolakes.com
hellolisbon.com hellolisbon.com
hellolongmont.com hellolongmont.com
hellolowell.com hellolowell.com
hellolubbock.com hellolubbock.com
hellolynchburg.com hellolynchburg.com
hellomaceio.com hellomaceio.com
hellomamaroneck.com hellomamaroneck.com
hellomanila.com hellomanila.com
hellomarana.com hellomarana.com
hellomargate.com hellomargate.com
hellombabane.com hellombabane.com
hellomemphis.com hellomemphis.com
hellomesquite.com hellomesquite.com
hellomoraga.com hellomoraga.com
hellomorenovalley.com hellomorenovalley.com
hellomuharraq.com hellomuharraq.com
hellonanchang.com hellonanchang.com
hellonewport.com hellonewport.com
hellonorthfield.com hellonorthfield.com
hellooceancity.com hellooceancity.com
helloolathe.com helloolathe.com
helloopelika.com helloopelika.com
hellootsego.com hellootsego.com
hellopicayune.com hellopicayune.com
hellopleasantgrove.com hellopleasantgrove.com
helloplovdiv.com helloplovdiv.com
helloponca.com helloponca.com
hellorawalpindi.com hellorawalpindi.com
helloraymore.com helloraymore.com
hellorevere.com hellorevere.com
helloriverside.com helloriverside.com
hellorohnertpark.com hellorohnertpark.com
helloromulus.com helloromulus.com
helloroundrock.com helloroundrock.com
hellosafetyharbor.com hellosafetyharbor.com
hellosanangelo.com hellosanangelo.com
hellosanbernardino.com hellosanbernardino.com
hellosantaana.com hellosantaana.com
helloscottsdale.com helloscottsdale.com
hellosiouxcity.com hellosiouxcity.com
helloskokie.com helloskokie.com
hellosmyrna.com hellosmyrna.com
hellosouthaven.com hellosouthaven.com
hellosulphur.com hellosulphur.com
hellosunprairie.com hellosunprairie.com
hellotaiyuan.com hellotaiyuan.com
hellotonga.com hellotonga.com
hellotwinsburg.com hellotwinsburg.com
hellovail.com hellovail.com
hellovalparaiso.com hellovalparaiso.com
hellovanburen.com hellovanburen.com
hellovientiane.com hellovientiane.com
hellovirginiabeach.com hellovirginiabeach.com
hellowestlafayette.com hellowestlafayette.com
hellowoodlandhills.com hellowoodlandhills.com
hellowoodstock.com hellowoodstock.com
helloyork.com helloyork.com
highdefdigest.com highdefdigest.com
historynet.com historynet.com
hollywoodreporter.com hollywoodreporter.com
jplay.com.au jplay.com.au
maindy.co.uk maindy.co.uk
ohiosportsman.com ohiosportsman.com
readpl.com readpl.com
readamericanfootball.com readamericanfootball.com
readtottenham.com readtottenham.com
pcgamer.com pcgamer.com
piperforum.com piperforum.com
achoylake.com achoylake.com
airforcetimes.com airforcetimes.com
audizine.com audizine.com
the-gadgeteer.com the-gadgeteer.com
thetechgame.com thetechgame.com
vinepair.com vinepair.com
dornob.com dornob.com
endurocross.com endurocross.com
everydaydiabeticrecipes.com everydaydiabeticrecipes.com
givemesport.com givemesport.com
gofugyourself.com gofugyourself.com
helloaberdeen.com helloaberdeen.com
helloalmadabad.com helloalmadabad.com
helloamarillo.com helloamarillo.com
helloamritsar.com helloamritsar.com
helloannarbor.com helloannarbor.com
helloardmore.com helloardmore.com
helloarlingtonheights.com helloarlingtonheights.com
helloavenal.com helloavenal.com
hellobaghdad.com hellobaghdad.com
hellobangdung.com hellobangdung.com
hellobeijing.com hellobeijing.com
hellobeiliu.com hellobeiliu.com
hellobelize.com hellobelize.com
hellobielefeld.com hellobielefeld.com
hellobismarck.com hellobismarck.com
hellobloomington.com hellobloomington.com
hellobradenton.com hellobradenton.com
hellocabot.com hellocabot.com
hellocaloocan.com hellocaloocan.com
hellocedarrapids.com hellocedarrapids.com
hellochandler.com hellochandler.com
hellochemnitz.com hellochemnitz.com
hellochesterfield.com hellochesterfield.com
helloclevelandheights.com helloclevelandheights.com
hellodaniabeach.com hellodaniabeach.com
hellodenmark.com hellodenmark.com
hellodetroit.com hellodetroit.com
hellodownersgrove.com hellodownersgrove.com
helloduquedecaxias.com helloduquedecaxias.com
helloeldorado.com helloeldorado.com
helloellensburg.com helloellensburg.com
helloelsalvador.com helloelsalvador.com
helloevansville.com helloevansville.com
hellofarmersbranch.com hellofarmersbranch.com
hellofayetteville.com hellofayetteville.com
helloflint.com helloflint.com
hellofortwaltonbeach.com hellofortwaltonbeach.com
hellofuxin.com hellofuxin.com
hellogaborone.com hellogaborone.com
hellogateshead.com hellogateshead.com
helloglendale.com helloglendale.com
hellograyslake.com hellograyslake.com
hellogreenbay.com hellogreenbay.com
helloguadalajara.com helloguadalajara.com
hellogulfshores.com hellogulfshores.com
hellogwangju.com hellogwangju.com
hellohannibal.com hellohannibal.com
hellohattiesburg.com hellohattiesburg.com
hellohayward.com hellohayward.com
hellohelena.com hellohelena.com
helloherriman.com helloherriman.com
helloimperialbeach.com helloimperialbeach.com
helloindianapolis.com helloindianapolis.com
helloiowacity.com helloiowacity.com
helloirvine.com helloirvine.com
hellojerseycity.com hellojerseycity.com
hellokaunas.com hellokaunas.com
hellokumasi.com hellokumasi.com
hellolamatanza.com hellolamatanza.com
helloleeds.com helloleeds.com
helloleipzig.com helloleipzig.com
helloliberal.com helloliberal.com
hellolittleton.com hellolittleton.com
hellolivonia.com hellolivonia.com
hellolongbeach.com hellolongbeach.com
hellolosangeles.com hellolosangeles.com
hellomanassaspark.com hellomanassaspark.com
hellomcallen.com hellomcallen.com
hellomequon.com hellomequon.com
hellomethuen.com hellomethuen.com
hellominden.com hellominden.com
hellominnetonka.com hellominnetonka.com
hellomodesto.com hellomodesto.com
hellomountainbrook.com hellomountainbrook.com
hellomuskogee.com hellomuskogee.com
hellomyrtlebeach.com hellomyrtlebeach.com
hellonicholasville.com hellonicholasville.com
hellonorthplatte.com hellonorthplatte.com
hellonorthsaltlake.com hellonorthsaltlake.com
hellooaklandpark.com hellooaklandpark.com
hellookayama.com hellookayama.com
helloorlando.com helloorlando.com
helloouterbanks.com helloouterbanks.com
helloowatonna.com helloowatonna.com
hellopalmademallorca.com hellopalmademallorca.com
hellopampa.com hellopampa.com
helloperrysburg.com helloperrysburg.com
helloplano.com helloplano.com
hellopuebla.com hellopuebla.com
hellopuertorico.com hellopuertorico.com
hellopyongyang.com hellopyongyang.com
hellorepentigny.com hellorepentigny.com
helloroanoke.com helloroanoke.com
hellosalford.com hellosalford.com
hellosanfernando.com hellosanfernando.com
hellosanfrancisco.com hellosanfrancisco.com
hellosantaclarita.com hellosantaclarita.com
hellosantafe.com hellosantafe.com
helloseattle.com helloseattle.com
helloseguin.com helloseguin.com
hellosendai.com hellosendai.com
helloshymkent.com helloshymkent.com
hellosiouxfalls.com hellosiouxfalls.com
hellospanishfork.com hellospanishfork.com
hellospartanburg.com hellospartanburg.com
hellostuttgart.com hellostuttgart.com
hellosuizhou.com hellosuizhou.com
hellosuperior.com hellosuperior.com
hellotacoma.com hellotacoma.com
hellothessaloniki.com hellothessaloniki.com
hellotianshui.com hellotianshui.com
hellotopeka.com hellotopeka.com
hellowaco.com hellowaco.com
hellowestlinn.com hellowestlinn.com
hellowestpalmbeach.com hellowestpalmbeach.com
hellowilmette.com hellowilmette.com
hellowinona.com hellowinona.com
hellowyandotte.com hellowyandotte.com
helloyuba.com helloyuba.com
inhabitat.com inhabitat.com
kcmha.ca kcmha.ca
list25.com list25.com
livescience.com livescience.com
marinecorpstimes.com marinecorpstimes.com
matadornetwork.com matadornetwork.com
metalinjection.net metalinjection.net
parentingisnteasy.co parentingisnteasy.co
popdust.com popdust.com
rabbitdogs.net rabbitdogs.net
rwbhc.co.uk rwbhc.co.uk
sailingworld.com sailingworld.com
space.com space.com
12up.com 12up.com
tomsguide.com tomsguide.com
tractorforum.com tractorforum.com
tvbeurope.com tvbeurope.com
biggboss2.net biggboss2.net
utvdriver.com utvdriver.com
walterfootball.com walterfootball.com
wciu.com wciu.com
cookstr.com cookstr.com
cruisingworld.com cruisingworld.com
digitalcameraworld.com digitalcameraworld.com
fishstock.com fishstock.com
helloadelanto.com helloadelanto.com
helloagra.com helloagra.com
helloallenpark.com helloallenpark.com
helloanoka.com helloanoka.com
helloarequipa.com helloarequipa.com
helloaugusta.com helloaugusta.com
hellobali.com hellobali.com
hellobangkok.com hellobangkok.com
hellobasra.com hellobasra.com
hellobenbrook.com hellobenbrook.com
helloblacksburg.com helloblacksburg.com
hellobogra.com hellobogra.com
hellobowlinggreen.com hellobowlinggreen.com
hellobrigham.com hellobrigham.com
hellobrookpark.com hellobrookpark.com
hellobrownsville.com hellobrownsville.com
hellobullhead.com hellobullhead.com
helloburbank.com helloburbank.com
helloburnaby.com helloburnaby.com
hellobydgoszcz.com hellobydgoszcz.com
hellocasselberry.com hellocasselberry.com
hellocaymanislands.com hellocaymanislands.com
hellocheyenne.com hellocheyenne.com
hellochiba.com hellochiba.com
hellocloquet.com hellocloquet.com
hellocoralsprings.com hellocoralsprings.com
hellocorcoran.com hellocorcoran.com
hellocrevecoeur.com hellocrevecoeur.com
hellodanbury.com hellodanbury.com
hellodaye.com hellodaye.com
hellodearbornheights.com hellodearbornheights.com
hellodelano.com hellodelano.com
hellodelraybeach.com hellodelraybeach.com
hellodeltona.com hellodeltona.com
helloeaglepass.com helloeaglepass.com
helloedinburgh.com helloedinburgh.com
helloedmonton.com helloedmonton.com
helloelmonte.com helloelmonte.com
helloelreno.com helloelreno.com
helloescondido.com helloescondido.com
helloeuless.com helloeuless.com
hellofairbanks.com hellofairbanks.com
helloforestlake.com helloforestlake.com
hellofortlauderdale.com hellofortlauderdale.com
hellofranklinpark.com hellofranklinpark.com
hellogainesville.com hellogainesville.com
hellogibraltar.com hellogibraltar.com
hellograndforks.com hellograndforks.com
hellogreenfield.com hellogreenfield.com
hellogujranwala.com hellogujranwala.com
hellohamlake.com hellohamlake.com
hellohamtramck.com hellohamtramck.com
hellohartford.com hellohartford.com
hellohialeahgardens.com hellohialeahgardens.com
hellohornlake.com hellohornlake.com
hellohouma.com hellohouma.com
helloislamabad.com helloislamabad.com
hellojamaica.com hellojamaica.com
hellojohnsoncity.com hellojohnsoncity.com
hellokelso.com hellokelso.com
hellokemerovo.com hellokemerovo.com
hellokermanshah.com hellokermanshah.com
helloklamathfalls.com helloklamathfalls.com
helloknoxville.com helloknoxville.com
hellokuna.com hellokuna.com
hellokursk.com hellokursk.com
hellolafayette.com hellolafayette.com
hellolagrande.com hellolagrande.com
hellolancaster.com hellolancaster.com
hellolaporte.com hellolaporte.com
hellolaspalmas.com hellolaspalmas.com
hellolittlerock.com hellolittlerock.com
helloloslunas.com helloloslunas.com
hellomachesneypark.com hellomachesneypark.com
hellomauldin.com hellomauldin.com
hellomeriden.com hellomeriden.com
hellomonticello.com hellomonticello.com
hellomoore.com hellomoore.com
hellomuskego.com hellomuskego.com
hellonaypyidaw.com hellonaypyidaw.com
hellonewark.com hellonewark.com
hellonewberg.com hellonewberg.com
hellonewnan.com hellonewnan.com
hellonewportrichey.com hellonewportrichey.com
hellonewsmyrnabeach.com hellonewsmyrnabeach.com
hellonorthlittlerock.com hellonorthlittlerock.com
hellooakforest.com hellooakforest.com
hellooklahomacity.com hellooklahomacity.com
hellookmulgee.com hellookmulgee.com
helloorangeburg.com helloorangeburg.com
hellooshkosh.com hellooshkosh.com
hellooxnard.com hellooxnard.com
hellopanamacity.com hellopanamacity.com
helloparagould.com helloparagould.com
hellopeabody.com hellopeabody.com
hellopinellaspark.com hellopinellaspark.com
hellopingdu.com hellopingdu.com
helloportarthur.com helloportarthur.com
helloporthueneme.com helloporthueneme.com
helloprovidence.com helloprovidence.com
helloqom.com helloqom.com
helloredondobeach.com helloredondobeach.com
hellorexburg.com hellorexburg.com
helloriverbank.com helloriverbank.com
helloroyalpalmbeach.com helloroyalpalmbeach.com
hellosaintthomas.com hellosaintthomas.com
hellosalina.com hellosalina.com
hellosanantonio.com hellosanantonio.com
hellosanbenito.com hellosanbenito.com
hellosanluispotosi.com hellosanluispotosi.com
helloselma.com helloselma.com
helloseymour.com helloseymour.com
hellosouthfield.com hellosouthfield.com
hellostamford.com hellostamford.com
hellosteubenville.com hellosteubenville.com
hellosudan.com hellosudan.com
hellotalladega.com hellotalladega.com
hellotampa.com hellotampa.com
hellotijuana.com hellotijuana.com
hellotula.com hellotula.com
hellotulare.com hellotulare.com
hellotulsa.com hellotulsa.com
hellounitedkingdom.com hellounitedkingdom.com
hellouniversitypark.com hellouniversitypark.com
hellourbana.com hellourbana.com
helloutrecht.com helloutrecht.com
hellovaldosta.com hellovaldosta.com
hellovegas.com hellovegas.com
hellovienna.com hellovienna.com
hellovladimir.com hellovladimir.com
hellowakeforest.com hellowakeforest.com
hellowarwick.com hellowarwick.com
hellowestallis.com hellowestallis.com
hellowestpoint.com hellowestpoint.com
hellowestchicago.com hellowestchicago.com
hellowestcovina.com hellowestcovina.com
hellowestjordan.com hellowestjordan.com
hellowichita.com hellowichita.com
hellowindsor.com hellowindsor.com
helloyerevan.com helloyerevan.com
helloyorbalinda.com helloyorbalinda.com
helloyuzhou.com helloyuzhou.com
hotbikeweb.com hotbikeweb.com
knowyourmeme.com knowyourmeme.com
libertyproject.com libertyproject.com
livestrong.com livestrong.com
michigan-sportsman.com michigan-sportsman.com
motorcyclistonline.com motorcyclistonline.com
outdoorlife.com outdoorlife.com
politifact.com politifact.com
popsci.com popsci.com
poynter.org poynter.org
rawstory.com rawstory.com
readfulham.com readfulham.com
readtv.co readtv.co
readwsl.com readwsl.com
airlinepilotforums.com airlinepilotforums.com
smallbizdaily.com smallbizdaily.com
arkansashunting.net arkansashunting.net
auto123.com auto123.com
thebestdessertrecipes.com thebestdessertrecipes.com
bagshotcc.co.uk bagshotcc.co.uk
bleepingcomputer.com bleepingcomputer.com
boomsbeat.com boomsbeat.com
wrestlinginc.com wrestlinginc.com
ealingcc.co.uk ealingcc.co.uk
ehow.co.uk ehow.co.uk
favequilts.com favequilts.com
firearmstalk.com firearmstalk.com
friaryscouts.com friaryscouts.com
gamingsym.com gamingsym.com
gunandgame.com gunandgame.com
heavy.com heavy.com
helloagawam.com helloagawam.com
helloalexandria.com helloalexandria.com
helloaltamontesprings.com helloaltamontesprings.com
helloandover.com helloandover.com
helloanqiu.com helloanqiu.com
helloarizona.com helloarizona.com
helloauburnhills.com helloauburnhills.com
helloavonlake.com helloavonlake.com
hellobarnaul.com hellobarnaul.com
hellobasrah.com hellobasrah.com
hellobeaumont.com hellobeaumont.com
hellobellaire.com hellobellaire.com
hellobeverlyhills.com hellobeverlyhills.com
hellobocaraton.com hellobocaraton.com
helloboston.com helloboston.com
hellobrazzaville.com hellobrazzaville.com
hellobrooklynpark.com hellobrooklynpark.com
hellobuffalo.com hellobuffalo.com
hellobulawayo.com hellobulawayo.com
hellocatania.com hellocatania.com
hellocathedral.com hellocathedral.com
hellocarrboro.com hellocarrboro.com
hellocedarpark.com hellocedarpark.com
hellochampaign.com hellochampaign.com
hellocheboksary.com hellocheboksary.com
helloclearwater.com helloclearwater.com
helloclemson.com helloclemson.com
hellocochabamba.com hellocochabamba.com
hellodayton.com hellodayton.com
hellodaytonabeach.com hellodaytonabeach.com
hellodesoto.com hellodesoto.com
hellodover.com hellodover.com
helloduisburg.com helloduisburg.com
helloduncan.com helloduncan.com
hellodurham.com hellodurham.com
hellodyersburg.com hellodyersburg.com
helloeastlake.com helloeastlake.com
helloedenprairie.com helloedenprairie.com
helloelcerrito.com helloelcerrito.com
helloelmwoodpark.com helloelmwoodpark.com
helloennis.com helloennis.com
helloerie.com helloerie.com
helloerlanger.com helloerlanger.com
hellofairfield.com hellofairfield.com
hellofife.com hellofife.com
helloforestpark.com helloforestpark.com
hellofortworth.com hellofortworth.com
hellofrontroyal.com hellofrontroyal.com
hellogarfieldheights.com hellogarfieldheights.com
hellogolden.com hellogolden.com
hellogothenburg.com hellogothenburg.com
hellogreensboro.com hellogreensboro.com
hellogreenville.com hellogreenville.com
hellogriffin.com hellogriffin.com
hellohaltonhills.com hellohaltonhills.com
hellohamilton.com hellohamilton.com
hellohamm.com hellohamm.com
helloharrisburg.com helloharrisburg.com
hellohermosabeach.com hellohermosabeach.com
helloheze.com helloheze.com
hellohomerglen.com hellohomerglen.com
hellohongkong.com hellohongkong.com
hellohouston.com hellohouston.com
helloithaca.com helloithaca.com
hellojacksonhole.com hellojacksonhole.com
hellojenks.com hellojenks.com
hellojoplin.com hellojoplin.com
hellojuarez.com hellojuarez.com
hellokansascity.com hellokansascity.com
hellokharkiv.com hellokharkiv.com
hellokilleen.com hellokilleen.com
hellokingston.com hellokingston.com
hellokuwaitcity.com hellokuwaitcity.com
hellolaiwu.com hellolaiwu.com
hellolakeforest.com hellolakeforest.com
hellolakeinthehills.com hellolakeinthehills.com
hellolakezurich.com hellolakezurich.com
hellolaquinta.com hellolaquinta.com
helloleessummit.com helloleessummit.com
hellolemongrove.com hellolemongrove.com
hellolindenhurst.com hellolindenhurst.com
hellolomalinda.com hellolomalinda.com
hellolongueuil.com hellolongueuil.com
hellomandeville.com hellomandeville.com
hellomanteca.com hellomanteca.com
hellomarietta.com hellomarietta.com
hellomarinette.com hellomarinette.com
hellomedellin.com hellomedellin.com
hellomedina.com hellomedina.com
hellomilwaukie.com hellomilwaukie.com
hellomiramar.com hellomiramar.com
hellomoorhead.com hellomoorhead.com
hellomortongrove.com hellomortongrove.com
hellomoseslake.com hellomoseslake.com
hellomuncie.com hellomuncie.com
hellomykolaiv.com hellomykolaiv.com
hellonampa.com hellonampa.com
hellonaples.com hellonaples.com
hellonewhaven.com hellonewhaven.com
hellonewhope.com hellonewhope.com
hellonorthmankato.com hellonorthmankato.com
hellonorthogden.com hellonorthogden.com
hellonorway.com hellonorway.com
hellonovato.com hellonovato.com
hellooakpark.com hellooakpark.com
helloorangecounty.com helloorangecounty.com
helloorsk.com helloorsk.com
hellooverlandpark.com hellooverlandpark.com
hellopainesville.com hellopainesville.com
hellopalmbeach.com hellopalmbeach.com
helloparkforest.com helloparkforest.com
hellopenza.com hellopenza.com
hellophoenix.com hellophoenix.com
hellopierre.com hellopierre.com
hellopittsfield.com hellopittsfield.com
helloplover.com helloplover.com
hellopomona.com hellopomona.com
helloprichard.com helloprichard.com
helloradford.com helloradford.com
hellorichfield.com hellorichfield.com
helloriverfalls.com helloriverfalls.com
hellorockford.com hellorockford.com
helloscarsdale.com helloscarsdale.com
hellosereisaophoan.com hellosereisaophoan.com
helloshangqiu.com helloshangqiu.com
hellosouthsaltlake.com hellosouthsaltlake.com
hellostafford.com hellostafford.com
hellosunlandpark.com hellosunlandpark.com
hellotallahassee.com hellotallahassee.com
hellotarponsprings.com hellotarponsprings.com
hellotempe.com hellotempe.com
hellotexarkana.com hellotexarkana.com
hellothecolony.com hellothecolony.com
hellotullahoma.com hellotullahoma.com
helloutica.com helloutica.com
hellovicksburg.com hellovicksburg.com
hellovilnius.com hellovilnius.com
hellovladivostok.com hellovladivostok.com
hellovolgograd.com hellovolgograd.com
hellowarrensburg.com hellowarrensburg.com
hellowatauga.com hellowatauga.com
hellowauwatosa.com hellowauwatosa.com
hellowellington.com hellowellington.com
hellowhitebearlake.com hellowhitebearlake.com
helloworcester.com helloworcester.com
hellozaragoza.com hellozaragoza.com
hockeybuzz.com hockeybuzz.com
huskermax.com huskermax.com
indiantelevision.com indiantelevision.com
inspiremore.com inspiremore.com
makingstarwars.net makingstarwars.net
nafe.com nafe.com
natureworldnews.com natureworldnews.com
navytimes.com navytimes.com
nhra.com nhra.com
outdoorhub.com outdoorhub.com
pavementsucks.com pavementsucks.com
preparedsociety.com preparedsociety.com
readcardiff.com readcardiff.com
readlaliga.com readlaliga.com
readliverpoolfc.com readliverpoolfc.com
recipechatter.com recipechatter.com
saskchallengecup.com saskchallengecup.com
sciencetimes.com sciencetimes.com
seattlepi.com seattlepi.com
shabiba.com shabiba.com
stlyrics.com stlyrics.com
synonym.com synonym.com
thebiglead.com thebiglead.com
thegoatspot.net thegoatspot.net
thesnhl.com thesnhl.com
top5.com top5.com
tpwhl.com tpwhl.com
udahl.com udahl.com
birdsandblooms.com birdsandblooms.com
bizfluent.com bizfluent.com
boredomtherapy.com boredomtherapy.com
browardpalmbeach.com browardpalmbeach.com
ymcahc.ie ymcahc.ie
consequenceofsound.net consequenceofsound.net
cowboylyrics.com cowboylyrics.com
creativeincomeblog.com creativeincomeblog.com
cuidatudinero.com cuidatudinero.com
customercarecontacts.com customercarecontacts.com
davesgarden.com davesgarden.com
decades.com decades.com
devilshockey.org devilshockey.org
directexpose.com directexpose.com
electrek.co electrek.co
entertainmentforus.com entertainmentforus.com
gfmha.ca gfmha.ca
golf.co.uk golf.co.uk
gotceleb.com gotceleb.com
handitv.com handitv.com
helloaachen.com helloaachen.com
helloamman.com helloamman.com
helloarkansas.com helloarkansas.com
hellobalchsprings.com hellobalchsprings.com
hellobattambang.com hellobattambang.com
hellobrainerd.com hellobrainerd.com
hellobrampton.com hellobrampton.com
hellobridgeport.com hellobridgeport.com
hellobucheon.com hellobucheon.com
hellobuckscounty.com hellobuckscounty.com
hellocaledon.com hellocaledon.com
hellocalifornia.com hellocalifornia.com
hellochulavista.com hellochulavista.com
hellocleveland.com hellocleveland.com
hellocolorado.com hellocolorado.com
helloconcord.com helloconcord.com
hellocostamesa.com hellocostamesa.com
hellocraiova.com hellocraiova.com
hellocresthill.com hellocresthill.com
helloculiacan.com helloculiacan.com
hellodaejeon.com hellodaejeon.com
hellodanyang.com hellodanyang.com
hellodaqing.com hellodaqing.com
hellodecaturil.com hellodecaturil.com
hellodortmund.com hellodortmund.com
hellodudley.com hellodudley.com
helloeagan.com helloeagan.com
helloeastridge.com helloeastridge.com
helloflorida.com helloflorida.com
helloforestgrove.com helloforestgrove.com
hellofuqing.com hellofuqing.com
hellogallatin.com hellogallatin.com
hellogardengrove.com hellogardengrove.com
hellogilber.com hellogilber.com
helloglencove.com helloglencove.com
hellograndisland.com hellograndisland.com
hellograndrapids.com hellograndrapids.com
hellohamhung.com hellohamhung.com
hellohollysprings.com hellohollysprings.com
helloillinois.com helloillinois.com
helloisfahan.com helloisfahan.com
helloisrael.com helloisrael.com
hellokamloops.com hellokamloops.com
hellokansas.com hellokansas.com
hellolacoruna.com hellolacoruna.com
hellolauderhill.com hellolauderhill.com
hellolaval.com hellolaval.com
hellolefkada.com hellolefkada.com
hellolevis.com hellolevis.com
hellolianjiang.com hellolianjiang.com
hellolockport.com hellolockport.com
hellomadagascar.com hellomadagascar.com
hellomaine.com hellomaine.com
hellomannheim.com hellomannheim.com
hellomilford.com hellomilford.com
hellomineola.com hellomineola.com
hellomontebello.com hellomontebello.com
hellomountpleasant.com hellomountpleasant.com
hellomudanjiang.com hellomudanjiang.com
hellonantes.com hellonantes.com
hellonashville.com hellonashville.com
hellonebraska.com hellonebraska.com
hellonewbritain.com hellonewbritain.com
hellonewhampshire.com hellonewhampshire.com
hellonewmexico.com hellonewmexico.com
hellonewportbeach.com hellonewportbeach.com
hellonewportnews.com hellonewportnews.com
helloniamey.com helloniamey.com
hellonorthport.com hellonorthport.com
hellonorthvancouver.com hellonorthvancouver.com
hellooakland.com hellooakland.com
hellooakville.com hellooakville.com
hellopascagoula.com hellopascagoula.com
hellopickering.com hellopickering.com
hellopleasantprairie.com hellopleasantprairie.com
hellopompanobeach.com hellopompanobeach.com
hellopraia.com hellopraia.com
helloqidong.com helloqidong.com
helloreggiocalabria.com helloreggiocalabria.com
hellorichmond.com hellorichmond.com
hellorosemead.com hellorosemead.com
hellorostovondon.com hellorostovondon.com
hellorowlett.com hellorowlett.com
helloruian.com helloruian.com
hellosaginaw.com hellosaginaw.com
hellosaintcroix.com hellosaintcroix.com
hellosaoluis.com hellosaoluis.com
hellosarnia.com hellosarnia.com
helloscandinavia.com helloscandinavia.com
helloseville.com helloseville.com
hellosherbrooke.com hellosherbrooke.com
helloshouguang.com helloshouguang.com
hellosinteustatius.com hellosinteustatius.com
helloskopelos.com helloskopelos.com
hellosolanabeach.com hellosolanabeach.com
hellosouthbend.com hellosouthbend.com
hellosouthcarolina.com hellosouthcarolina.com
hellostevenspoint.com hellostevenspoint.com
hellosuwon.com hellosuwon.com
hellotemple.com hellotemple.com
helloterrebonne.com helloterrebonne.com
helloterrell.com helloterrell.com
hellotimisoara.com hellotimisoara.com
hellotogo.com hellotogo.com
hellotukwila.com hellotukwila.com
hellotver.com hellotver.com
helloulaanbaatar.com helloulaanbaatar.com
hellovaticancity.com hellovaticancity.com
hellovermont.com hellovermont.com
hellovillapark.com hellovillapark.com
helloweinan.com helloweinan.com
hellowestvirginia.com hellowestvirginia.com
hellowiesbaden.com hellowiesbaden.com
hellowilkesbarre.com hellowilkesbarre.com
hellowilsonville.com hellowilsonville.com
hellowoodlandpark.com hellowoodlandpark.com
helloxinyang.com helloxinyang.com
history101.com history101.com
historyanswers.co.uk historyanswers.co.uk
hothardware.com hothardware.com
ibtimes.com ibtimes.com
itproportal.com itproportal.com
luxandlush.com luxandlush.com
marlinmag.com marlinmag.com
missouriwhitetails.com missouriwhitetails.com
mmajunkie.com mmajunkie.com
ninjabeat.com ninjabeat.com
readfootball.co readfootball.co
readgolf.com readgolf.com
readhull.com readhull.com
readtennis.co readtennis.co
pcrmra.ca pcrmra.ca
phoenixnewtimes.com phoenixnewtimes.com
registercitizen.com registercitizen.com
readbournemouth.com readbournemouth.com
readchampionship.com readchampionship.com
airdrieunited-mad.co.uk airdrieunited-mad.co.uk
armytimes.com armytimes.com
allaccess.com allaccess.com
antonym.com antonym.com
sportfishingmag.com sportfishingmag.com
abc57.com abc57.com
svengoolie.com svengoolie.com
techlicious.com techlicious.com
theawesomer.com theawesomer.com
azlyrics.com azlyrics.com
readwestbrom.com readwestbrom.com
becauseofthemwecan.com becauseofthemwecan.com
trails.com trails.com
trueself.com trueself.com
bhaskar.com bhaskar.com
bjpenn.com bjpenn.com
bmgmediasolutions.com bmgmediasolutions.com
boxofficeindia.com boxofficeindia.com
wonderwall.com wonderwall.com
zksrilanka.com zksrilanka.com
cinemablend.com cinemablend.com
citiblog.co.uk citiblog.co.uk
familyevents.com familyevents.com
dunfermlineathletic-mad.co.uk dunfermlineathletic-mad.co.uk
ehowenespanol.com ehowenespanol.com
favesouthernrecipes.com favesouthernrecipes.com
followfollow.com followfollow.com
footballfancast.com footballfancast.com
helloaguascalientes.com helloaguascalientes.com
helloalamogordo.com helloalamogordo.com
helloalbany.com helloalbany.com
helloanyang.com helloanyang.com
helloasmara.com helloasmara.com
helloasuncion.com helloasuncion.com
helloaustin.com helloaustin.com
hellobandarlampung.com hellobandarlampung.com
hellobatavia.com hellobatavia.com
hellobensenville.com hellobensenville.com
hellobessemer.com hellobessemer.com
hellobowie.com hellobowie.com
hellobuenapark.com hellobuenapark.com
hellocedarhill.com hellocedarhill.com
hellochamplin.com hellochamplin.com
hellochangde.com hellochangde.com
hellochillicothe.com hellochillicothe.com
helloclarington.com helloclarington.com
hellococoabeach.com hellococoabeach.com
hellocollegepark.com hellocollegepark.com
hellocottagegrove.com hellocottagegrove.com
hellocudahy.com hellocudahy.com
hellocupertino.com hellocupertino.com
hellodatong.com hellodatong.com
hellodel.com hellodel.com
hellodelaware.com hellodelaware.com
helloeastbethel.com helloeastbethel.com
helloelmirage.com helloelmirage.com
helloelpaso.com helloelpaso.com
helloencinitas.com helloencinitas.com
hellofes.com hellofes.com
hellogalati.com hellogalati.com
hellogoiania.com hellogoiania.com
hellogoyang.com hellogoyang.com
helloguadeloupe.com helloguadeloupe.com
helloguangyuan.com helloguangyuan.com
helloguiping.com helloguiping.com
hellohaiphong.com hellohaiphong.com
hellohandan.com hellohandan.com
hellohaora.com hellohaora.com
hellohengyang.com hellohengyang.com
hellohiltonhead.com hellohiltonhead.com
helloholladay.com helloholladay.com
hellohuntingtonbeach.com hellohuntingtonbeach.com
helloindiana.com helloindiana.com
helloindianola.com helloindianola.com
helloindiantrail.com helloindiantrail.com
hellojalgaon.com hellojalgaon.com
hellojianyang.com hellojianyang.com
hellojining.com hellojining.com
hellokhulna.com hellokhulna.com
helloliege.com helloliege.com
hellolincolnpark.com hellolincolnpark.com
helloliuyang.com helloliuyang.com
hellolouisiana.com hellolouisiana.com
helloluoyang.com helloluoyang.com
hellomapleridge.com hellomapleridge.com
hellomarseilles.com hellomarseilles.com
hellomessina.com hellomessina.com
hellomianyang.com hellomianyang.com
hellomikonos.com hellomikonos.com
hellonanan.com hellonanan.com
hellonanyang.com hellonanyang.com
helloneworleans.com helloneworleans.com
hellonewwestminster.com hellonewwestminster.com
hellonizhnynovgorod.com hellonizhnynovgorod.com
hellonorthdakota.com hellonorthdakota.com
hellonorthlasvegas.com hellonorthlasvegas.com
helloogden.com helloogden.com
hellooman.com hellooman.com
helloonalaska.com helloonalaska.com
helloostrava.com helloostrava.com
hellooswego.com hellooswego.com
hellopalmdesert.com hellopalmdesert.com
hellopennsylvania.com hellopennsylvania.com
hellopetaluma.com hellopetaluma.com
hellopittsburg.com hellopittsburg.com
hellopoway.com hellopoway.com
hellopoznan.com hellopoznan.com
hellopretoria.com hellopretoria.com
helloqianjiang.com helloqianjiang.com
helloranchocucamonga.com helloranchocucamonga.com
helloreims.com helloreims.com
hellorennes.com hellorennes.com
hellorolla.com hellorolla.com
helloryazan.com helloryazan.com
hellosaintetienne.com hellosaintetienne.com
hellosaintmaarten.com hellosaintmaarten.com
hellosamara.com hellosamara.com
hellosangabriel.com hellosangabriel.com
hellosartell.com hellosartell.com
hellosedalia.com hellosedalia.com
helloslidell.com helloslidell.com
hellosoledad.com hellosoledad.com
hellosouthdakota.com hellosouthdakota.com
hellospringhill.com hellospringhill.com
hellosuining.com hellosuining.com
hellotaishan.com hellotaishan.com
helloteresina.com helloteresina.com
hellotexasusa.com hellotexasusa.com
hellotianmen.com hellotianmen.com
hellotrenton.com hellotrenton.com
hellotshwane.com hellotshwane.com
hellotyumen.com hellotyumen.com
hellounionca.com hellounionca.com
hellovirginiausa.com hellovirginiausa.com
helloweifang.com helloweifang.com
hellowestmont.com hellowestmont.com
hellowhitefishbay.com hellowhitefishbay.com
helloxining.com helloxining.com
hellozakynthos.com hellozakynthos.com
hellozhanjiang.com hellozhanjiang.com
justmommies.com justmommies.com
laraza.com laraza.com
latintimes.com latintimes.com
mrfood.com mrfood.com
obsev.com obsev.com
orlandoweekly.com orlandoweekly.com
pointstreak.com pointstreak.com
portageminorhockey.com portageminorhockey.com
riverfronttimes.com riverfronttimes.com
rugby.co.uk rugby.co.uk
sackvilleminorhockey.ca sackvilleminorhockey.ca
sacurrent.com sacurrent.com
scribol.com scribol.com
airlinepilotcentral.com airlinepilotcentral.com
articlebio.com articlebio.com
sleafordcc.co.uk sleafordcc.co.uk
splitcoaststampers.com splitcoaststampers.com
sportsmedia101.com sportsmedia101.com
sunset.com sunset.com
allfreekidscrafts.com allfreekidscrafts.com
technabob.com technabob.com
vectisrugby.co.uk vectisrugby.co.uk
blackburnrovers-mad.co.uk blackburnrovers-mad.co.uk
blogher.com blogher.com
weddingbee.com weddingbee.com
westword.com westword.com
broadwayworld.com broadwayworld.com
celebmafia.com celebmafia.com
celebsugar.com celebsugar.com
chron.com chron.com
cnwhc.co.uk cnwhc.co.uk
cvba.ca cvba.ca
cyclingnews.com cyclingnews.com
defensenews.com defensenews.com
dundeeunited-mad.co.uk dundeeunited-mad.co.uk
equestriadaily.com equestriadaily.com
esportslatest.com esportslatest.com
ggha.ca ggha.ca
gizmodo.co.uk gizmodo.co.uk
guyandtheblog.com guyandtheblog.com
haslemererugby.co.uk haslemererugby.co.uk
helloacworth.com helloacworth.com
helloahwaz.com helloahwaz.com
helloalgonquin.com helloalgonquin.com
helloamorgos.com helloamorgos.com
helloansonia.com helloansonia.com
helloartesia.com helloartesia.com
helloaurora.com helloaurora.com
helloavondale.com helloavondale.com
hellobahamas.com hellobahamas.com
hellobayonne.com hellobayonne.com
hellobelgorod.com hellobelgorod.com
hellobujumbura.com hellobujumbura.com
hellocarmel.com hellocarmel.com
hellochapelhill.com hellochapelhill.com
hellochowchilla.com hellochowchilla.com
hellocolombia.com hellocolombia.com
hellocoralgables.com hellocoralgables.com
hellodallas.com hellodallas.com
hellodenver.com hellodenver.com
hellodoral.com hellodoral.com
helloeastpeoria.com helloeastpeoria.com
hellofalklandislands.com hellofalklandislands.com
hellogardena.com hellogardena.com
hellogongzhuling.com hellogongzhuling.com
helloguigang.com helloguigang.com
hellohagen.com hellohagen.com
hellohanahan.com hellohanahan.com
hellohechuan.com hellohechuan.com
hellohims.com hellohims.com
hellohopkinsville.com hellohopkinsville.com
hellohuainan.com hellohuainan.com
hellojacksonvillebeach.com hellojacksonvillebeach.com
hellojinjiang.com hellojinjiang.com
hellokaohsiung.com hellokaohsiung.com
hellokent.com hellokent.com
hellokingman.com hellokingman.com
hellolavergne.com hellolavergne.com
hellolawrenceville.com hellolawrenceville.com
helloleesburg.com helloleesburg.com
helloleicester.com helloleicester.com
hellolibreville.com hellolibreville.com
hellologansport.com hellologansport.com
hellolublin.com hellolublin.com
helloludhiana.com helloludhiana.com
hellomariupol.com hellomariupol.com
hellomichigan.com hellomichigan.com
hellomombasa.com hellomombasa.com
hellomoncton.com hellomoncton.com
hellomonrovia.com hellomonrovia.com
hellomontereypark.com hellomontereypark.com
hellomontserrat.com hellomontserrat.com
hellomysore.com hellomysore.com
helloneijiang.com helloneijiang.com
hellonewbedford.com hellonewbedford.com
hellonewburyport.com hellonewburyport.com
hellonewjersey.com hellonewjersey.com
hellonewyork.com hellonewyork.com
hellonorthmyrtlebeach.com hellonorthmyrtlebeach.com
helloocala.com helloocala.com
hellooceansprings.com hellooceansprings.com
hellopacificbeach.com hellopacificbeach.com
hellopadova.com hellopadova.com
hellopalmbay.com hellopalmbay.com
hellopalmsprings.com hellopalmsprings.com
helloparamount.com helloparamount.com
hellopawtucket.com hellopawtucket.com
hellopeekskill.com hellopeekskill.com
hellopensacola.com hellopensacola.com
hellopristina.com hellopristina.com
helloredwood.com helloredwood.com
hellorichmondhill.com hellorichmondhill.com
hellorochester.com hellorochester.com
hellorockhill.com hellorockhill.com
hellorockvillecentre.com hellorockvillecentre.com
hellosaintnevis.com hellosaintnevis.com
hellosaintvincent.com hellosaintvincent.com
hellosamarkand.com hellosamarkand.com
hellosandwell.com hellosandwell.com
hellosanjose.com hellosanjose.com
hellosanrafael.com hellosanrafael.com
hellosantafesprings.com hellosantafesprings.com
hellosearcy.com hellosearcy.com
helloshreveport.com helloshreveport.com
hellosolapur.com hellosolapur.com
hellosouthgate.com hellosouthgate.com
hellosrinagar.com hellosrinagar.com
hellostatecollege.com hellostatecollege.com
hellotaichung.com hellotaichung.com
hellotangier.com hellotangier.com
hellotennessee.com hellotennessee.com
hellothane.com hellothane.com
hellotorreon.com hellotorreon.com
hellotroisrivieres.com hellotroisrivieres.com
helloulsan.com helloulsan.com
hellouniversal.com hellouniversal.com
hellowadsworth.com hellowadsworth.com
hellowesthaven.com hellowesthaven.com
hellowhitehall.com hellowhitehall.com
hellowuppertal.com hellowuppertal.com
helloxingyang.com helloxingyang.com
helloyarmouth.com helloyarmouth.com
helloyiyang.com helloyiyang.com
helloyonkers.com helloyonkers.com
hipointfirearmsforums.com hipointfirearmsforums.com
howtoadult.com howtoadult.com
imore.com imore.com
islands.com islands.com
kanatabasketball.ca kanatabasketball.ca
kaorinusantara.or.id kaorinusantara.or.id
laopinion.com laopinion.com
manchestercity-mad.co.uk manchestercity-mad.co.uk
maplesofthawks.com maplesofthawks.com
metrotimes.com metrotimes.com
mynation.com mynation.com
newstimes.com newstimes.com
oola.com oola.com
oswh.ca oswh.ca
pnwriders.com pnwriders.com
readcricket.com readcricket.com
readmanutd.com readmanutd.com
roughmaps.com roughmaps.com
scroll.in scroll.in
scunthorpeunited-mad.co.uk scunthorpeunited-mad.co.uk
sfmha.ca sfmha.ca
shoppinglifestyle.com shoppinglifestyle.com
spaceanswers.com spaceanswers.com
sportdiver.com sportdiver.com
sportskeeda.com sportskeeda.com
stourbridgefc.com stourbridgefc.com
stwalburghockey.com stwalburghockey.com
superstreetbike.com superstreetbike.com
svconline.com svconline.com
allfreecrochet.com allfreecrochet.com
techradar.com techradar.com
timesofoman.com timesofoman.com
toptenz.net toptenz.net
ultrasurfing.com ultrasurfing.com
uppercanadacyclones.com uppercanadacyclones.com
canveyislandfc.com canveyislandfc.com
carolinahuddle.com carolinahuddle.com
yourdictionary.com yourdictionary.com
cbs58.com cbs58.com
cdmha.ca cdmha.ca
corshamcc.co.uk corshamcc.co.uk
creativebloq.com creativebloq.com
deccanherald.com deccanherald.com
dirtrider.com dirtrider.com
doverathletic-mad.co.uk doverathletic-mad.co.uk
dronedj.com dronedj.com
femalehockeychallenge.com femalehockeychallenge.com
folkestonerugbyclub.co.uk folkestonerugbyclub.co.uk
fountainof30.com fountainof30.com
georgiapacking.org georgiapacking.org
glockforum.com glockforum.com
goneoutdoors.com goneoutdoors.com
happybeinghealthy.com happybeinghealthy.com
helloalameda.com helloalameda.com
helloanegada.com helloanegada.com
helloanshan.com helloanshan.com
helloastrakhan.com helloastrakhan.com
helloaventura.com helloaventura.com
hellobazhong.com hellobazhong.com
hellobenicia.com hellobenicia.com
hellobolton.com hellobolton.com
hellobrighton.com hellobrighton.com
helloburlingame.com helloburlingame.com
hellocoloradospings.com hellocoloradospings.com
hellocrowley.com hellocrowley.com
hellocrownpoint.com hellocrownpoint.com
hellodaytona.com hellodaytona.com
hellodebrecen.com hellodebrecen.com
hellodeserthotsprings.com hellodeserthotsprings.com
hellodesmoines.com hellodesmoines.com
hellodestin.com hellodestin.com
hellodnipro.com hellodnipro.com
hellodominicanrepublic.com hellodominicanrepublic.com
hellodoncaster.com hellodoncaster.com
hellodouglas.com hellodouglas.com
hellodrummondville.com hellodrummondville.com
helloegypt.com helloegypt.com
helloelgin.com helloelgin.com
helloeunice.com helloeunice.com
helloeureka.com helloeureka.com
hellofortcollins.com hellofortcollins.com
hellofortmyers.com hellofortmyers.com
hellofrankfort.com hellofrankfort.com
hellogaithersburg.com hellogaithersburg.com
hellogarland.com hellogarland.com
hellogdynia.com hellogdynia.com
hellogelsenkirchen.com hellogelsenkirchen.com
hellogeorgia.com hellogeorgia.com
hellogijon.com hellogijon.com
hellogreenwich.com hellogreenwich.com
hellohaicheng.com hellohaicheng.com
hellohaimen.com hellohaimen.com
hellohannover.com hellohannover.com
hellohopewell.com hellohopewell.com
hellohurricane.com hellohurricane.com
hellojabalpur.com hellojabalpur.com
hellojamshedpur.com hellojamshedpur.com
hellojessore.com hellojessore.com
hellojordan.com hellojordan.com
hellojuba.com hellojuba.com
hellokaifeng.com hellokaifeng.com
hellokawarthalakes.com hellokawarthalakes.com
hellokazan.com hellokazan.com
hellokurgan.com hellokurgan.com
hellolakeland.com hellolakeland.com
hellolawrence.com hellolawrence.com
hellolebanon.com hellolebanon.com
hellolufeng.com hellolufeng.com
hellomassachusetts.com hellomassachusetts.com
hellomesa.com hellomesa.com
hellomidland.com hellomidland.com
hellominnesota.com hellominnesota.com
hellomontanausa.com hellomontanausa.com
hellomultan.com hellomultan.com
hellomurrieta.com hellomurrieta.com
hellonaucalpan.com hellonaucalpan.com
hellonevada.com hellonevada.com
hellonorthcarolina.com hellonorthcarolina.com
helloohio.com helloohio.com
hellooviedo.com hellooviedo.com
hellopalatine.com hellopalatine.com
hellopaloalto.com hellopaloalto.com
helloparma.com helloparma.com
hellopassaic.com hellopassaic.com
hellopflugerville.com hellopflugerville.com
hellopingdingshan.com hellopingdingshan.com
helloportland.com helloportland.com
helloprincegeorge.com helloprincegeorge.com
hellorosemount.com hellorosemount.com
hellosaintjerome.com hellosaintjerome.com
hellosaintmartin.com hellosaintmartin.com
hellosandiego.com hellosandiego.com
hellosanibelisland.com hellosanibelisland.com
hellosaultstemarie.com hellosaultstemarie.com
hellosausalito.com hellosausalito.com
hellosebastian.com hellosebastian.com
hellosheboygan.com hellosheboygan.com
helloshelbyville.com helloshelbyville.com
hellosherman.com hellosherman.com
helloshijiazhuang.com helloshijiazhuang.com
helloskiathos.com helloskiathos.com
hellostcatharines.com hellostcatharines.com
hellostudiocity.com hellostudiocity.com
hellosugarland.com hellosugarland.com
helloszczecin.com helloszczecin.com
hellotashkent.com hellotashkent.com
hellothehague.com hellothehague.com
hellotrieste.com hellotrieste.com
hellotualatin.com hellotualatin.com
helloturkscaicos.com helloturkscaicos.com
hellotwentyninepalms.com hellotwentyninepalms.com
hellovadodara.com hellovadodara.com
hellowafangdian.com hellowafangdian.com
hellowoodland.com hellowoodland.com
hellowujiang.com hellowujiang.com
hellozaporizhia.com hellozaporizhia.com
irlamvale.co.uk irlamvale.co.uk
kmmohockey.org kmmohockey.org
lovetoknow.com lovetoknow.com
lyricsondemand.com lyricsondemand.com
mirchi9.com mirchi9.com
musicradar.com musicradar.com
oabo.ca oabo.ca
okz.ca okz.ca
ourmidland.com ourmidland.com
penguinmd.com penguinmd.com
prepbaseballreport.com prepbaseballreport.com
radioworld.com radioworld.com
readbasketball.com readbasketball.com
readfilm.co readfilm.co
realitypod.com realitypod.com
actoniansrfc.com actoniansrfc.com
rumbunter.com rumbunter.com
rushthecourt.net rushthecourt.net
santabanta.com santabanta.com
archauthority.com archauthority.com
sbobrfc.co.uk sbobrfc.co.uk
sci-techmaven.io sci-techmaven.io
science101.com science101.com
sdfpl.co.uk sdfpl.co.uk
ahoramismo.com ahoramismo.com
ardsrugby.co.uk ardsrugby.co.uk
secondnexus.com secondnexus.com
aiyinsitanblog.ml aiyinsitanblog.ml
sgvtribune.com sgvtribune.com
allfreecopycatrecipes.com allfreecopycatrecipes.com
allfreeholidaycrafts.com allfreeholidaycrafts.com
showt.com showt.com
allucanheat.com allucanheat.com
armchairgeneral.com armchairgeneral.com
skmov.com skmov.com
skywayshoutout.com skywayshoutout.com
animalchannel.co animalchannel.co
somha.ca somha.ca
apnamudda.com apnamudda.com
soy502.com soy502.com
soycarmin.com soycarmin.com
spartanavenue.com spartanavenue.com
sport.co.uk sport.co.uk
srsoccerleague.ca srsoccerleague.ca
strettynews.com strettynews.com
stripehype.com stripehype.com
abaceltics.ca abaceltics.ca
survivinginfidelity.com survivinginfidelity.com
anganwadirecruitment.in anganwadirecruitment.in
atraccion360.com atraccion360.com
telemundowi.com telemundowi.com
thaivisa.com thaivisa.com
cardiffcity-mad.co.uk cardiffcity-mad.co.uk
awinninghabit.com awinninghabit.com
thecanuckway.com thecanuckway.com
theglhl.com theglhl.com
azchords.com azchords.com
theedd.ca theedd.ca
thehindu.com thehindu.com
thelandryhat.com thelandryhat.com
bachpan.com bachpan.com
themobileindian.com themobileindian.com
thepoliticalinsider.com thepoliticalinsider.com
thestokesnews.com thestokesnews.com
thongsbridgecricketclub.co.uk thongsbridgecricketclub.co.uk
bamsmackpow.com bamsmackpow.com
threebridgesfc.co.uk threebridgesfc.co.uk
tikout.com tikout.com
timesherald.com timesherald.com
tollypics.com tollypics.com
tolucalabellacd.com tolucalabellacd.com
bermudatriplecrown.com bermudatriplecrown.com
beyondtheflag.com beyondtheflag.com
uintacountyherald.com uintacountyherald.com
ukulele-chords.com ukulele-chords.com
bia2.tv bia2.tv
uniondailytimes.com uniondailytimes.com
bitrixc.info bitrixc.info
veblr.com veblr.com
vegashockeyknight.com vegashockeyknight.com
bobcatattack.com bobcatattack.com
boilingwithbias.com boilingwithbias.com
boltonwanderers-mad.co.uk boltonwanderers-mad.co.uk
wbir.com wbir.com
wcoanimedub.tv wcoanimedub.tv
wcoanimesub.tv wcoanimesub.tv
wcoastswing.com wcoastswing.com
wildcatbluenation.com wildcatbluenation.com
bsmf.ca bsmf.ca
wimp.com wimp.com
wittyfeed.tv wittyfeed.tv
wjbq.com wjbq.com
buffalowdown.com buffalowdown.com
wkyc.com wkyc.com
burlington-record.com burlington-record.com
worldofsolitaire.com worldofsolitaire.com
worldwideinterweb.com worldwideinterweb.com
writingillini.com writingillini.com
cafecrime.com cafecrime.com
yabo0990.com yabo0990.com
yallalive.tv yallalive.tv
youlike89.com youlike89.com
ccjhl.net ccjhl.net
ccmb.co.uk ccmb.co.uk
zoffar.com zoffar.com
cltampa.com cltampa.com
coloradodaily.com coloradodaily.com
curiosity.com curiosity.com
dailycamera.com dailycamera.com
dailyknicks.com dailyknicks.com
dairylandexpress.com dairylandexpress.com
designyourway.net designyourway.net
dimensionsmagazine.com dimensionsmagazine.com
doramatv.live doramatv.live
draftthreads.com draftthreads.com
dynamitenews.com dynamitenews.com
ebonybird.com ebonybird.com
ebook3000.biz ebook3000.biz
eclecticesoterica.com eclecticesoterica.com
egotastic.com egotastic.com
eldiariony.com eldiariony.com
eleconomistaamerica.com eleconomistaamerica.com
eleconomistaamerica.pe eleconomistaamerica.pe
eluniversal.com.co eluniversal.com.co
empireofthekop.com empireofthekop.com
esakal.com esakal.com
expreso.ec expreso.ec
ezwatercalculator.com ezwatercalculator.com
francetabs.com francetabs.com
frozenfutures.com frozenfutures.com
fulltvshows.org fulltvshows.org
gardenguides.com gardenguides.com
gbcmag.com gbcmag.com
gcmha.com gcmha.com
gearbrain.com gearbrain.com
ggpan.com ggpan.com
ginadwagner.com ginadwagner.com
glamsham.com glamsham.com
greenwichtime.com greenwichtime.com
gtaall.net gtaall.net
gtavicecity.ru gtavicecity.ru
gujaratimidday.com gujaratimidday.com
hagomitarea.com hagomitarea.com
hamiltonacademical-mad.co.uk hamiltonacademical-mad.co.uk
helloalhambra.com helloalhambra.com
helloalton.com helloalton.com
helloanguilla.com helloanguilla.com
helloanniston.com helloanniston.com
hellobangor.com hellobangor.com
hellobeaverton.com hellobeaverton.com
hellobelton.com hellobelton.com
helloburton.com helloburton.com
hellocenterville.com hellocenterville.com
hellocerritos.com hellocerritos.com
helloclarksdale.com helloclarksdale.com
hellocollinsville.com hellocollinsville.com
hellocompton.com hellocompton.com
hellodecatur.com hellodecatur.com
hellodecatural.com hellodecatural.com
hellodelmar.com hellodelmar.com
hellodesplaines.com hellodesplaines.com
helloelcentro.com helloelcentro.com
helloelmira.com helloelmira.com
helloencino.com helloencino.com
helloevans.com helloevans.com
hellofridley.com hellofridley.com
hellogarner.com hellogarner.com
hellografton.com hellografton.com
hellograndville.com hellograndville.com
hellogranite.com hellogranite.com
hellogreer.com hellogreer.com
hellohaverhill.com hellohaverhill.com
hellohazelwood.com hellohazelwood.com
hellohazleton.com hellohazleton.com
hellohempsteadvillage.com hellohempsteadvillage.com
hellohendersonville.com hellohendersonville.com
hellohoover.com hellohoover.com
hellojackson.com hellojackson.com
hellojapan.com hellojapan.com
hellojonesboro.com hellojonesboro.com
hellokaysville.com hellokaysville.com
hellokearney.com hellokearney.com
hellolakecharles.com hellolakecharles.com
helloleague.com helloleague.com
hellolexington.com hellolexington.com
hellolosgatos.com hellolosgatos.com
hellomadison.com hellomadison.com
hellomaryland.com hellomaryland.com
hellomcalester.com hellomcalester.com
hellomokena.com hellomokena.com
hellomustang.com hellomustang.com
hellomykonos.com hellomykonos.com
hellonorthadams.com hellonorthadams.com
hellonorthlauderdale.com hellonorthlauderdale.com
hellopearland.com hellopearland.com
hellopendleton.com hellopendleton.com
hellopickerington.com hellopickerington.com
hellopoquoson.com hellopoquoson.com
helloqueens.com helloqueens.com
helloramsey.com helloramsey.com
hellorobbinsdale.com hellorobbinsdale.com
hellorockledge.com hellorockledge.com
helloroselle.com helloroselle.com
hellosachse.com hellosachse.com
hellosanger.com hellosanger.com
helloscranton.com helloscranton.com
hellosherwood.com hellosherwood.com
hellosnellville.com hellosnellville.com
hellosolon.com hellosolon.com
hellosouthholland.com hellosouthholland.com
hellostillwater.com hellostillwater.com
hellostpeters.com hellostpeters.com
hellosudbury.com hellosudbury.com
hellotallmadge.com hellotallmadge.com
hellothornton.com hellothornton.com
hellotifton.com hellotifton.com
hellotooele.com hellotooele.com
hellotortola.com hellotortola.com
hellovirgingorda.com hellovirgingorda.com
hellovirginislands.com hellovirginislands.com
hellowaltham.com hellowaltham.com
hellowestspringfield.com hellowestspringfield.com
hellowilmington.com hellowilmington.com
hellowoodbury.com hellowoodbury.com
helloworthington.com helloworthington.com
hhringette.ca hhringette.ca
hiddenremote.com hiddenremote.com
hoy.com.do hoy.com.do
hoyosrevenge.com hoyosrevenge.com
idcmha.ca idcmha.ca
indiaparenting.com indiaparenting.com
inkonindy.com inkonindy.com
insideibrox.com insideibrox.com
jpost.com jpost.com
kgha.ca kgha.ca
kingsofkauffman.com kingsofkauffman.com
kltigersrfc.com kltigersrfc.com
koimoi.com koimoi.com
kumudam.com kumudam.com
raisingzona.com raisingzona.com
lametropolesports.com lametropolesports.com
lanacion.com.ar lanacion.com.ar
lastwordonsports.com lastwordonsports.com
leasticoulddo.com leasticoulddo.com
leytonorient-mad.co.uk leytonorient-mad.co.uk
miaminewtimes.com miaminewtimes.com
lifebru.com lifebru.com
lombardiave.com lombardiave.com
lwos.life lwos.life
lwosports.com lwosports.com
lyricsmania.com lyricsmania.com
mdzol.com mdzol.com
mendotareporter.com mendotareporter.com
mercurynews.com mercurynews.com
michigansthumb.com michigansthumb.com
motorcitybengals.com motorcitybengals.com
mpsctoday.com mpsctoday.com
mtgsideboard.com mtgsideboard.com
nertazw.com nertazw.com
netflixlife.com netflixlife.com
newcastleunited-mad.co.uk newcastleunited-mad.co.uk
newsbugz.com newsbugz.com
nflmocks.com nflmocks.com
ramblinfan.com ramblinfan.com
nhknightshockey.com nhknightshockey.com
nigeriaworld.com nigeriaworld.com
nipawinmha.ca nipawinmha.ca
nocartridge.com nocartridge.com
range365.com range365.com
northbankrsl.com northbankrsl.com
novelcool.com novelcool.com
nugglove.com nugglove.com
obozrevatel.com obozrevatel.com
odishatv.in odishatv.in
oomph.co.id oomph.co.id
openlist.com openlist.com
orangeintheoven.com orangeintheoven.com
otowns11.com otowns11.com
ottawalittlesens.com ottawalittlesens.com
parolesmania.com parolesmania.com
readberserk.com readberserk.com
readbundesliga.com readbundesliga.com
readchelsea.com readchelsea.com
readshowbiz.co readshowbiz.co
readstoke.com readstoke.com
phpclasses.hu phpclasses.hu
picbear.org picbear.org
pikstagram.net pikstagram.net
pottsmerc.com pottsmerc.com
pricepanda.com.my pricepanda.com.my
proceso.com.mx proceso.com.mx
puckettspond.com puckettspond.com
punchng.com punchng.com
quiltingboard.com quiltingboard.com
redwoodtimes.com redwoodtimes.com
reginaballhockey.com reginaballhockey.com
rhodyrampage.com rhodyrampage.com
rickheinz.com rickheinz.com
arbroath-mad.co.uk arbroath-mad.co.uk
rmx.com.mx rmx.com.mx
readceltic.com readceltic.com
bradfordcity-mad.co.uk bradfordcity-mad.co.uk
sabrenoise.com sabrenoise.com
saturdayblitz.com saturdayblitz.com
catflyph.com catflyph.com
saucyrecipes.com saucyrecipes.com
seamsandscissors.com seamsandscissors.com
shabdkosh.com shabdkosh.com
arrowheadaddict.com arrowheadaddict.com
allfreecasserolerecipes.com allfreecasserolerecipes.com
allfreediyweddings.com allfreediyweddings.com
am66g.com am66g.com
simbaly.com simbaly.com
ankaclan.com ankaclan.com
slamonline.com slamonline.com
slotbackwaggle.com slotbackwaggle.com
smdsc.com.au smdsc.com.au
aptoslife.com aptoslife.com
apmha.org apmha.org
sportdfw.com sportdfw.com
stamfordadvocate.com stamfordadvocate.com
1007sandiego.com 1007sandiego.com
stlfinder.com stlfinder.com
1428elm.com 1428elm.com
readligue1.com readligue1.com
advocate-news.com advocate-news.com
albat.com.mx albat.com.mx
surfer.com surfer.com
swanagefc.com swanagefc.com
aspsnippets.com aspsnippets.com
taxguru.in taxguru.in
atozproxy.com atozproxy.com
teluguz.com teluguz.com
terezowens.com terezowens.com
tettybetty.com tettybetty.com
awkwardmom.com awkwardmom.com
ayrunited-mad.co.uk ayrunited-mad.co.uk
backgrounddownload.com backgrounddownload.com
therealdeal.com therealdeal.com
thesixthaxis.com thesixthaxis.com
balldurham.com balldurham.com
tidbitsofexperience.com tidbitsofexperience.com
tigerland.com tigerland.com
baseballoshawa.com baseballoshawa.com
bawarchi.com bawarchi.com
bbmha.ca bbmha.ca
bearinsider.com bearinsider.com
beaumontenterprise.com beaumontenterprise.com
beebom.com beebom.com
behindwoods.com behindwoods.com
travelingmom.com travelingmom.com
truthandaction.org truthandaction.org
ttcp5577.com ttcp5577.com
tvline.com tvline.com
typingclub.com typingclub.com
ukiahdailyjournal.com ukiahdailyjournal.com
biabcalculator.com biabcalculator.com
bikemag.com bikemag.com
bikez.biz bikez.biz
vanderhoofminorhockey.ca vanderhoofminorhockey.ca
blackfaldsminorhockey.com blackfaldsminorhockey.com
bladenjournal.com bladenjournal.com
videotoolbox.com videotoolbox.com
vivaligamx.com vivaligamx.com
bobvila.com bobvila.com
wales-mad.co.uk wales-mad.co.uk
boundingintocomics.com boundingintocomics.com
bricksareawesome.com bricksareawesome.com
whathifi.com whathifi.com
brookingsregister.com brookingsregister.com
windowscentral.com windowscentral.com
bustingbrackets.com bustingbrackets.com
wrfc.net wrfc.net
bysi.ca bysi.ca
wxc-yl.com wxc-yl.com
wyrk.com wyrk.com
xclient.info xclient.info
calltothepen.com calltothepen.com
hailfloridahail.com hailfloridahail.com
canaln.pe canaln.pe
capebretontradesmen.com capebretontradesmen.com
cardiaccane.com cardiaccane.com
care2.com care2.com
yesplz.co yesplz.co
causewaycrowd.com causewaycrowd.com
ysyl222.com ysyl222.com
cincyontheprowl.com cincyontheprowl.com
cityofchampionssports.com cityofchampionssports.com
clintonnc.com clintonnc.com
cobrashockeyaa.net cobrashockeyaa.net
convertfiles.com convertfiles.com
couleeregionsledhockey.com couleeregionsledhockey.com
cpdynamo.com cpdynamo.com
craftster.org craftster.org
dailyarmy.com dailyarmy.com
dailydemocrat.com dailydemocrat.com
dallasobserver.com dallasobserver.com
data-base.pro data-base.pro
dbltap.com dbltap.com
devilsindetail.com devilsindetail.com
didyouknowfacts.com didyouknowfacts.com
dinamalar.com dinamalar.com
dinamani.com dinamani.com
discuss.com.hk discuss.com.hk
divyabhaskar.co.in divyabhaskar.co.in
dlrccricket.com dlrccricket.com
dwmhoa.com dwmhoa.com
familyhandyman.com familyhandyman.com
einerd.com.br einerd.com.br
eldestaperadio.com eldestaperadio.com
eleconomistaamerica.co eleconomistaamerica.co
elheraldo.hn elheraldo.hn
elsivar24.com elsivar24.com
empirewritesback.com empirewritesback.com
entertainmentdaily.co.uk entertainmentdaily.co.uk
expressnews.com expressnews.com
extratimetalk.com extratimetalk.com
factoryofsadness.co factoryofsadness.co
fairfieldcitizenonline.com fairfieldcitizenonline.com
fantasysharks.com fantasysharks.com
fashionnewsera.com fashionnewsera.com
fifthdomain.com fifthdomain.com
firstcry.com firstcry.com
five2go.com five2go.com
foxyoxie.com foxyoxie.com
fsm-media.com fsm-media.com
gem021.com gem021.com
giants365.com giants365.com
goanddomichigan.com goanddomichigan.com
gobmha.ca gobmha.ca
goldengatesports.com goldengatesports.com
harbourcitylakersringette.com harbourcitylakersringette.com
hdtuto.com hdtuto.com
helloabbeville.com helloabbeville.com
helloammon.com helloammon.com
helloangleton.com helloangleton.com
helloarlington.com helloarlington.com
hellobrooklyncenter.com hellobrooklyncenter.com
hellocapecod.com hellocapecod.com
hellocarbondale.com hellocarbondale.com
hellocartersville.com hellocartersville.com
hellocicero.com hellocicero.com
hellocolleyville.com hellocolleyville.com
hellocrestwood.com hellocrestwood.com
hellodenison.com hellodenison.com
hellododge.com hellododge.com
helloeastlansing.com helloeastlansing.com
helloeastorange.com helloeastorange.com
helloedmond.com helloedmond.com
helloedwardsville.com helloedwardsville.com
helloelkriver.com helloelkriver.com
hellogadsden.com hellogadsden.com
hellogoldenvalley.com hellogoldenvalley.com
hellogoldsboro.com hellogoldsboro.com
hellogreendale.com hellogreendale.com
hellohercules.com hellohercules.com
hellohermiston.com hellohermiston.com
hellohiltonheadisland.com hellohiltonheadisland.com
hellohollywood.com hellohollywood.com
hellohutchinson.com hellohutchinson.com
helloinkster.com helloinkster.com
hellokenner.com hellokenner.com
hellokingsville.com hellokingsville.com
hellokinston.com hellokinston.com
hellolahabra.com hellolahabra.com
hellolansing.com hellolansing.com
helloleawood.com helloleawood.com
hellolemoore.com hellolemoore.com
helloleominster.com helloleominster.com
hellolivermore.com hellolivermore.com
hellolyon.com hellolyon.com
hellomacon.com hellomacon.com
hellomaplevalley.com hellomaplevalley.com
hellomaryville.com hellomaryville.com
hellomattoon.com hellomattoon.com
hellomendocino.com hellomendocino.com
hellomiamilakes.com hellomiamilakes.com
hellomorganton.com hellomorganton.com
hellonetherlands.com hellonetherlands.com
hellonewlondon.com hellonewlondon.com
hellonogales.com hellonogales.com
hellonorthampton.com hellonorthampton.com
hellonorthcanton.com hellonorthcanton.com
hellooakharbor.com hellooakharbor.com
hellooklahoma.com hellooklahoma.com
helloowensboro.com helloowensboro.com
hellopalmdale.com hellopalmdale.com
helloparkland.com helloparkland.com
helloparmaheights.com helloparmaheights.com
hellopaterson.com hellopaterson.com
hellopineville.com hellopineville.com
hellopinole.com hellopinole.com
helloplantation.com helloplantation.com
helloportage.com helloportage.com
helloportchester.com helloportchester.com
helloportwashington.com helloportwashington.com
helloquincy.com helloquincy.com
hellorhodeisland.com hellorhodeisland.com
hellorussellville.com hellorussellville.com
hellosanjuancapistrano.com hellosanjuancapistrano.com
hellosanmarcos.com hellosanmarcos.com
hellosantarosa.com hellosantarosa.com
helloschererville.com helloschererville.com
hellosouthsanfrancisco.com hellosouthsanfrancisco.com
hellostarkville.com hellostarkville.com
hellostatesboro.com hellostatesboro.com
hellosummerville.com hellosummerville.com
hellotemecula.com hellotemecula.com
hellotrotwood.com hellotrotwood.com
hellotucson.com hellotucson.com
hellovadnaisheights.com hellovadnaisheights.com
hellovisalia.com hellovisalia.com
hellowatsonville.com hellowatsonville.com
hellowaynesboro.com hellowaynesboro.com
hellowestcolumbia.com hellowestcolumbia.com
hellowestland.com hellowestland.com
hellowilliamsport.com hellowilliamsport.com
hellozion.com hellozion.com
heraldspot.com heraldspot.com
hindijeevansathi.in hindijeevansathi.in
hindisahayta.in hindisahayta.in
hip-hopvibe.com hip-hopvibe.com
hiplatina.com hiplatina.com
hket-work.com hket-work.com
housesforrent.ws housesforrent.ws
houstonpress.com houstonpress.com
hrfc.ca hrfc.ca
huskercorner.com huskercorner.com
iasexamportal.com iasexamportal.com
imleagues.com imleagues.com
iranitv.com iranitv.com
itsolutionstuff.com itsolutionstuff.com
java2novice.com java2novice.com
jugofsnyder.com jugofsnyder.com
kens5.com kens5.com
kingjamesgospel.com kingjamesgospel.com
lakers365.com lakers365.com
lakeshowlife.com lakeshowlife.com
laprensagrafica.com laprensagrafica.com
lawlessrepublic.com lawlessrepublic.com
letterboxd.com letterboxd.com
lifeandstylemag.com lifeandstylemag.com
lincolncity-mad.co.uk lincolncity-mad.co.uk
luusports.com luusports.com
lyrster.com lyrster.com
mainlinemedianews.com mainlinemedianews.com
manacinema.com manacinema.com
marca.com marca.com
miramichiminorhockey.ca miramichiminorhockey.ca
mlsmultiplex.com mlsmultiplex.com
mmasucka.com mmasucka.com
montevistajournal.com montevistajournal.com
morecambe-mad.co.uk morecambe-mad.co.uk
mybama.com mybama.com
newtonaycliffefc.co.uk newtonaycliffefc.co.uk
ninernoise.com ninernoise.com
novahockey.ca novahockey.ca
nsmmhl.com nsmmhl.com
numismaster.com numismaster.com
nvshl.org nvshl.org
nymag.com nymag.com
octopusthrower.com octopusthrower.com
odishareporter.in odishareporter.in
okmagazine.com okmagazine.com
olehottytoddy.com olehottytoddy.com
olsmj.com olsmj.com
omhahockey.ca omhahockey.ca
redbluffdailynews.com redbluffdailynews.com
opwhl.com opwhl.com
paininthearsenal.com paininthearsenal.com
redmarleyfc.co.uk redmarleyfc.co.uk
parentztalk.com parentztalk.com
penslabyrinth.com penslabyrinth.com
pikstagram.org pikstagram.org
plainsman.com plainsman.com
plmha.ca plmha.ca
pokespost.com pokespost.com
popcrush.com popcrush.com
prajavani.net prajavani.net
premierballhockey.net premierballhockey.net
pressandguide.com pressandguide.com
presstelegram.com presstelegram.com
pricepanda.co.id pricepanda.co.id
problitz.com problitz.com
puradsi.com puradsi.com
qqsssj.com qqsssj.com
racer.com racer.com
ran-myrosso.com ran-myrosso.com
rayscoloredglasses.com rayscoloredglasses.com
riverfrontball.com riverfrontball.com
rochakkhabare.com rochakkhabare.com
robesonian.com robesonian.com
acrediteounao.com acrediteounao.com
accessauburn.com accessauburn.com
sachhoc.com sachhoc.com
saintjohnstone-mad.co.uk saintjohnstone-mad.co.uk
sammichespsychmeds.com sammichespsychmeds.com
saskatoonredwings.ca saskatoonredwings.ca
saracensamateurrugby.com saracensamateurrugby.com
sbsun.com sbsun.com
agdaily.com agdaily.com
seattletimes.com seattletimes.com
airalamo.com airalamo.com
senshot.com senshot.com
arsenal-world.co.uk arsenal-world.co.uk
setalarmclock.net setalarmclock.net
allfreechristmascrafts.com allfreechristmascrafts.com
shootforthestarshockey.com shootforthestarshockey.com
silverbelt.com silverbelt.com
slambasketball.ca slambasketball.ca
skyelitenews.com skyelitenews.com
spacecityscoop.com spacecityscoop.com
spikeduppsychedup.com spikeduppsychedup.com
sportspyder.com sportspyder.com
0199962.com 0199962.com
12thmanrising.com 12thmanrising.com
subject.com.ua subject.com.ua
suntamiltv.net suntamiltv.net
syriaohr.com syriaohr.com
tasteofcountry.com tasteofcountry.com
atlantafire.com atlantafire.com
techlearning.com techlearning.com
audiophix.com audiophix.com
aula2pl.com aula2pl.com
awkward.com awkward.com
thedailymash.co.uk thedailymash.co.uk
thejetpress.com thejetpress.com
thektog.org thektog.org
theprideoflondon.com theprideoflondon.com
torotimes.com torotimes.com
totalprosports.com totalprosports.com
trivia.com trivia.com
twgram.me twgram.me
uconndoit.com uconndoit.com
undeadwalking.com undeadwalking.com
bigredlouie.com bigredlouie.com
unionandblue.com unionandblue.com
upscsuccess.com upscsuccess.com
usmagazine.com usmagazine.com
bitul.in bitul.in
viral-centre.com viral-centre.com
blogredmachine.com blogredmachine.com
bobshideout.com bobshideout.com
boxingtribune-news.com boxingtribune-news.com
whshl.com whshl.com
whittierdailynews.com whittierdailynews.com
wiltonbulletin.com wiltonbulletin.com
bucksphoenixnc.co.uk bucksphoenixnc.co.uk
wndietcs.com wndietcs.com
wonderfeed.com wonderfeed.com
wpgtalkradio.com wpgtalkradio.com
wsbs.com wsbs.com
wsrkfm.com wsrkfm.com
camberleycc.co.uk camberleycc.co.uk
camhl.com camhl.com
yellowjackedup.com yellowjackedup.com
yourchords.com yourchords.com
catcrave.com catcrave.com
catholicnewsagency.com catholicnewsagency.com
caughtoffside.com caughtoffside.com
cbseportal.com cbseportal.com
celebritax.com celebritax.com
cesarsway.com cesarsway.com
cgsentinel.com cgsentinel.com
zonazealots.com zonazealots.com
chatib.us chatib.us
churchpop.com churchpop.com
circuitdigest.com circuitdigest.com
ciudad.com.ar ciudad.com.ar
closerweekly.com closerweekly.com
coinagereport.com coinagereport.com
coloradohometownweekly.com coloradohometownweekly.com
courttv.com courttv.com
coventrycity-mad.co.uk coventrycity-mad.co.uk
cubbiescrib.com cubbiescrib.com
cufla.ca cufla.ca
dailyfreeman.com dailyfreeman.com
davidlebovitz.com davidlebovitz.com
ddmba.net ddmba.net
discordhelp.net discordhelp.net
diversitybestpractices.com diversitybestpractices.com
doctorlib.info doctorlib.info
domino.com domino.com
dundee-mad.co.uk dundee-mad.co.uk
eleconomistaamerica.com.ar eleconomistaamerica.com.ar
eleconomistaamerica.com.br eleconomistaamerica.com.br
eluniversaldiario.com eluniversaldiario.com
emeraldcityswagger.com emeraldcityswagger.com
eptrail.com eptrail.com
esportsx.com esportsx.com
exmouthrugby.co.uk exmouthrugby.co.uk
falkirk-mad.co.uk falkirk-mad.co.uk
filehippo.com filehippo.com
foodchannel.com foodchannel.com
forensicfilesnow.com forensicfilesnow.com
fortune.com fortune.com
fraghero.com fraghero.com
freelandfc.co.uk freelandfc.co.uk
friarsonbase.com friarsonbase.com
gaara.ca gaara.ca
gamesided.com gamesided.com
getsongbpm.com getsongbpm.com
girlbossesrock.com girlbossesrock.com
gogram.club gogram.club
goldandgopher.com goldandgopher.com
golfwrx.com golfwrx.com
gonepuckwild.com gonepuckwild.com
govipersgo.com govipersgo.com
graduatez.com graduatez.com
gridironexperts.com gridironexperts.com
gridironnewjersey.com gridironnewjersey.com
gtaall.com gtaall.com
gtaall.com.br gtaall.com.br
gtaall.eu gtaall.eu
guelphminorfootball.net guelphminorfootball.net
haribhoomi.com haribhoomi.com
helloblueisland.com helloblueisland.com
hellobossier.com hellobossier.com
hellobrowndeer.com hellobrowndeer.com
hellobrownwood.com hellobrownwood.com
hellocarlsbad.com hellocarlsbad.com
helloceres.com helloceres.com
hellocharlottesville.com hellocharlottesville.com
helloclemmons.com helloclemmons.com
hellocookeville.com hellocookeville.com
hellocortland.com hellocortland.com
hellocorvallis.com hellocorvallis.com
helloculpeper.com helloculpeper.com
helloeastcleveland.com helloeastcleveland.com
helloeaston.com helloeaston.com
hellofarmington.com hellofarmington.com
helloflight.com helloflight.com
hellofortsmith.com hellofortsmith.com
hellogallup.com hellogallup.com
hellogautier.com hellogautier.com
hellogreatbritain.com hellogreatbritain.com
hellogreenwood.com hellogreenwood.com
helloherndon.com helloherndon.com
hellohinesville.com hellohinesville.com
hellohuntley.com hellohuntley.com
hellokentwood.com hellokentwood.com
hellokerrville.com hellokerrville.com
helloketchikan.com helloketchikan.com
hellokiryasjoel.com hellokiryasjoel.com
hellolakejackson.com hellolakejackson.com
hellolamesa.com hellolamesa.com
hellolawton.com hellolawton.com
hellolayton.com hellolayton.com
hellolibertyville.com hellolibertyville.com
hellolisle.com hellolisle.com
hellolittlechute.com hellolittlechute.com
hellolovespark.com hellolovespark.com
hellomadisonville.com hellomadisonville.com
hellomapleheights.com hellomapleheights.com
hellomartinsville.com hellomartinsville.com
hellomarylandheights.com hellomarylandheights.com
hellomiddleton.com hellomiddleton.com
hellomissoula.com hellomissoula.com
hellomountclemens.com hellomountclemens.com
hellomurfreesboro.com hellomurfreesboro.com
hellonorthcharleston.com hellonorthcharleston.com
hellooakley.com hellooakley.com
helloopryland.com helloopryland.com
hellopapillion.com hellopapillion.com
hellopayson.com hellopayson.com
helloplymouth.com helloplymouth.com
helloportorange.com helloportorange.com
helloranchomirage.com helloranchomirage.com
helloreading.com helloreading.com
helloridgeland.com helloridgeland.com
hellorockyriver.com hellorockyriver.com
helloruston.com helloruston.com
hellosaintcloud.com hellosaintcloud.com
hellosantamaria.com hellosantamaria.com
helloshakerheights.com helloshakerheights.com
hellospokanevalley.com hellospokanevalley.com
hellospringboro.com hellospringboro.com
hellostaunton.com hellostaunton.com
hellosteamboatsprings.com hellosteamboatsprings.com
hellostockton.com hellostockton.com
hellostoughton.com hellostoughton.com
hellosumter.com hellosumter.com
hellotaiwan.com hellotaiwan.com
hellothomasville.com hellothomasville.com
hellotitusville.com hellotitusville.com
hellovannuys.com hellovannuys.com
hellowasco.com hellowasco.com
hellowentzville.com hellowentzville.com
hellowestminster.com hellowestminster.com
hellowheatridge.com hellowheatridge.com
hellowilkes-barre.com hellowilkes-barre.com
hellowillmar.com hellowillmar.com
homebrewtalk.com homebrewtalk.com
houseofhouston.com houseofhouston.com
houstonchronicle.com houstonchronicle.com
hrmladiesfastball.ca hrmladiesfastball.ca
indiaglitz.com indiaglitz.com
jrbanditsaaa.com jrbanditsaaa.com
kalakkalcinema.com kalakkalcinema.com
kemmerergazette.com kemmerergazette.com
kffl.com kffl.com
kiiitv.com kiiitv.com
lapatilla.com lapatilla.com
latina.com latina.com
laurinburgexchange.com laurinburgexchange.com
lfcdata.co.uk lfcdata.co.uk
lmhtf.com lmhtf.com
localpov.com localpov.com
lowellsun.com lowellsun.com
marlinmaniac.com marlinmaniac.com
meganews.mx meganews.mx
middlesbrough-mad.co.uk middlesbrough-mad.co.uk
midlevelexceptional.com midlevelexceptional.com
milehighsticking.com milehighsticking.com
militarytimes.com militarytimes.com
moodycountyenterprise.com moodycountyenterprise.com
morellmustangs.ca morellmustangs.ca
muscleandfitness.com muscleandfitness.com
mycolombianrecipes.com mycolombianrecipes.com
mydailyviral.com mydailyviral.com
namechk.com namechk.com
nbbha.com nbbha.com
ndusc.ca ndusc.ca
nnjie.com nnjie.com
nsrjhl.com nsrjhl.com
orlandomagicdaily.com orlandomagicdaily.com
rezysa.com rezysa.com
peterhead-mad.co.uk peterhead-mad.co.uk
phpclasses.org phpclasses.org
pilotmountainnews.com pilotmountainnews.com
pocketpence.co.uk pocketpence.co.uk
prcmba.ca prcmba.ca
percolately.com percolately.com
prizegrab.com prizegrab.com
punjabijeevansathi.in punjabijeevansathi.in
qysa.ca qysa.ca
readhuddersfield.com readhuddersfield.com
readhxh.com readhxh.com
readkingdom.com readkingdom.com
reckontalk.com reckontalk.com
reddevilarmada.com reddevilarmada.com
rmfhl.com rmfhl.com
aroundthefoghorn.com aroundthefoghorn.com
aberdeenminorhockey.ca aberdeenminorhockey.ca
rothiracryptowallet.com rothiracryptowallet.com
rslgha.ca rslgha.ca
rushthekop.com rushthekop.com
sahlonline.ca sahlonline.ca
sakaltimes.com sakaltimes.com
salud180.com salud180.com
samachar.com samachar.com
accringtonstanley-mad.co.uk accringtonstanley-mad.co.uk
section215.com section215.com
senbhl.net senbhl.net
sfchronicle.com sfchronicle.com
alamosanews.com alamosanews.com
allcougdup.com allcougdup.com
ashbridgesvolleyball.com ashbridgesvolleyball.com
siliconvalley.com siliconvalley.com
sixpackspeak.com sixpackspeak.com
soyfutbol.com soyfutbol.com
soytecno.com soytecno.com
androidheadlines.com androidheadlines.com
sputnikmusic.com sputnikmusic.com
srufc.com srufc.com
atlallday.com atlallday.com
stitchandunwind.com stitchandunwind.com
aberdeen-mad.co.uk aberdeen-mad.co.uk
acidigital.com acidigital.com
acistampa.com acistampa.com
actitudfem.com actitudfem.com
albat.com albat.com
svg.com svg.com
svha.ca svha.ca
alloverthehill.com alloverthehill.com
swzhockey.ca swzhockey.ca
szbjq.com szbjq.com
talking12.com talking12.com
tasteofhome.com tasteofhome.com
tellonym.me tellonym.me
textnow.com textnow.com
autoproyecto.com autoproyecto.com
thebaltimorewire.com thebaltimorewire.com
theboot.com theboot.com
thehuskyhaul.com thehuskyhaul.com
aztecscricketclub.com aztecscricketclub.com
baadultsoftball.com baadultsoftball.com
thereporteronline.com thereporteronline.com
thisisfutbol.com thisisfutbol.com
timesleader.com timesleader.com
timesnowtamil.com timesnowtamil.com
timesoccer.com timesoccer.com
tintero.com.ar tintero.com.ar
tipchasers.com tipchasers.com
tokeofthetown.com tokeofthetown.com
tomahawktake.com tomahawktake.com
bcbha.com bcbha.com
tri-townicearena.com tri-townicearena.com
twincities.com twincities.com
upliftingtoday.com upliftingtoday.com
uwants.com uwants.com
uwants.net uwants.net
birdswatcher.com birdswatcher.com
valleyofthesuns.com valleyofthesuns.com
bluelinestation.com bluelinestation.com
bosoxinjection.com bosoxinjection.com
brokensilenze.net brokensilenze.net
withthefirstpick.com withthefirstpick.com
wltx.com wltx.com
wokesloth.com wokesloth.com
wreckemred.com wreckemred.com
wrexham-mad.co.uk wrexham-mad.co.uk
wynncash11.com wynncash11.com
buzzypop.com buzzypop.com
bvbbuzz.com bvbbuzz.com
wycombewanderers-mad.co.uk wycombewanderers-mad.co.uk
xmenfansite.com xmenfansite.com
casebriefs.com casebriefs.com
cbhl.org cbhl.org
zetarepublic.com zetarepublic.com
ncregister.com ncregister.com
chmbarockets.com chmbarockets.com
cirencesterhockeyclub.co.uk cirencesterhockeyclub.co.uk
citybeat.com citybeat.com
clasificadospl.com clasificadospl.com
cngsports.ca cngsports.ca
components101.com components101.com
coolimba.com coolimba.com
cosmicbook.news cosmicbook.news
crawleyrfc.com crawleyrfc.com
csmba.ca csmba.ca
cumberlandminorhockey.ca cumberlandminorhockey.ca
dagenhamandredbridge-mad.co.uk dagenhamandredbridge-mad.co.uk
dailyholics.com dailyholics.com
deathvalleyvoice.com deathvalleyvoice.com
delconewsnetwork.com delconewsnetwork.com
diabeteshealthpage.com diabeteshealthpage.com
districtondeck.com districtondeck.com
draftsite.com draftsite.com
edexlive.com edexlive.com
edinburghcity-mad.co.uk edinburghcity-mad.co.uk
edmhunters.com edmhunters.com
egrfc.com egrfc.com
ehow.com.br ehow.com.br
ehpenguins.org ehpenguins.org
ekcowhitecapsfc.co.uk ekcowhitecapsfc.co.uk
elbotiquin.mx elbotiquin.mx
eldestapeweb.com eldestapeweb.com
eleconomista.com.mx eleconomista.com.mx
eleconomista.net eleconomista.net
elkintribune.com elkintribune.com
eltiempohoy.es eltiempohoy.es
emailondeck.com emailondeck.com
enpareja.com enpareja.com
enufh.com enufh.com
examveda.com examveda.com
fightful.com fightful.com
fightmatrix.com fightmatrix.com
fishersgateflyersfc.co.uk fishersgateflyersfc.co.uk
flameforthought.com flameforthought.com
foodieandthechef.com foodieandthechef.com
foodmeanderings.com foodmeanderings.com
fullmatchesandshows.com fullmatchesandshows.com
fundysoccernb.com fundysoccernb.com
gastronomyblog.com gastronomyblog.com
geardiary.com geardiary.com
gifimage.net gifimage.net
gmcacsports.org gmcacsports.org
gojhl.ca gojhl.ca
goldenbearlair.com goldenbearlair.com
guacamoley.com guacamoley.com
guelphknightsbasketball.ca guelphknightsbasketball.ca
guiadecocinafacil.com guiadecocinafacil.com
hawkeyenation.com hawkeyenation.com
helloalabamausa.com helloalabamausa.com
helloalbertville.com helloalbertville.com
helloappleton.com helloappleton.com
helloashwaubenon.com helloashwaubenon.com
hellobarbuda.com hellobarbuda.com
hellobarnstable.com hellobarnstable.com
hellobellgardens.com hellobellgardens.com
hellobigspring.com hellobigspring.com
hellobolivia.com hellobolivia.com
hellobrawley.com hellobrawley.com
hellocollegestation.com hellocollegestation.com
helloeasley.com helloeasley.com
helloedgewater.com helloedgewater.com
helloelpasoderobles.com helloelpasoderobles.com
helloelyria.com helloelyria.com
helloeustis.com helloeustis.com
helloevergreenpark.com helloevergreenpark.com
helloferguson.com helloferguson.com
helloferndale.com helloferndale.com
hellofountainvalley.com hellofountainvalley.com
hellograndjunction.com hellograndjunction.com
hellohaines.com hellohaines.com
hellohibbing.com hellohibbing.com
hellohuntington.com hellohuntington.com
hellojefferson.com hellojefferson.com
hellokenya.com hellokenya.com
hellokernersville.com hellokernersville.com
hellokettering.com hellokettering.com
hellokirksville.com hellokirksville.com
hellokirkwood.com hellokirkwood.com
hellolagrange.com hellolagrange.com
hellolagunabeach.com hellolagunabeach.com
hellolakeville.com hellolakeville.com
helloleander.com helloleander.com
hellolondon.com hellolondon.com
helloloveland.com helloloveland.com
hellolynwood.com hellolynwood.com
hellomadera.com hellomadera.com
hellomadisonheights.com hellomadisonheights.com
hellomchenry.com hellomchenry.com
hellomercerisland.com hellomercerisland.com
hellomidvale.com hellomidvale.com
hellomilpitas.com hellomilpitas.com
hellonewbrighton.com hellonewbrighton.com
hellonewzealand.com hellonewzealand.com
hellonoblesville.com hellonoblesville.com
hellonorris.com hellonorris.com
hellonorwood.com hellonorwood.com
hellonortonshores.com hellonortonshores.com
hellooakdale.com hellooakdale.com
hellooakridge.com hellooakridge.com
helloofallon.com helloofallon.com
hellooran.com hellooran.com
helloossining.com helloossining.com
hellopapuanewguinea.com hellopapuanewguinea.com
hellopatterson.com hellopatterson.com
helloportales.com helloportales.com
helloportangeles.com helloportangeles.com
helloracine.com helloracine.com
helloriverton.com helloriverton.com
hellorollingmeadows.com hellorollingmeadows.com
hellosanleandro.com hellosanleandro.com
hellosaukrapids.com hellosaukrapids.com
helloseminole.com helloseminole.com
hellosikeston.com hellosikeston.com
hellosomerville.com hellosomerville.com
hellostrongsville.com hellostrongsville.com
hellosusanville.com hellosusanville.com
hellosylvania.com hellosylvania.com
hellotaunton.com hellotaunton.com
hellotaylorsville.com hellotaylorsville.com
hellotinleypark.com hellotinleypark.com
hellotumwater.com hellotumwater.com
hellowestbend.com hellowestbend.com
hellowheeling.com hellowheeling.com
hellowhiteplains.com hellowhiteplains.com
hellowooster.com hellowooster.com
hmtvlive.com hmtvlive.com
honest-food.net honest-food.net
hoopshype.com hoopshype.com
humansoftumblr.com humansoftumblr.com
huskerboard.com huskerboard.com
iadityak.com iadityak.com
insidetheiggles.com insidetheiggles.com
insidetheloudhouse.com insidetheloudhouse.com
instagimg.com instagimg.com
iqhockey.ca iqhockey.ca
jamiiforums.com jamiiforums.com
jerusalemonline.com jerusalemonline.com
jigsawpuzz.com jigsawpuzz.com
jobtapu.com jobtapu.com
jsclasses.org jsclasses.org
julesburgadvocate.com julesburgadvocate.com
jyghxsm.com jyghxsm.com
kagstv.com kagstv.com
kbxhockey.com kbxhockey.com
kcentv.com kcentv.com
kemptvillehockey.com kemptvillehockey.com
kora-star.tv kora-star.tv
laprensafl.com laprensafl.com
laptopmag.com laptopmag.com
larnerfc.com larnerfc.com
leaf.tv leaf.tv
livingsharp.com livingsharp.com
lovebackyard.com lovebackyard.com
lwofs.com lwofs.com
maariv.co.il maariv.co.il
mdhlmi.com mdhlmi.com
mentalfloss.com mentalfloss.com
mtmad.es mtmad.es
musc.ca musc.ca
musselburghathleticfc.co.uk musselburghathleticfc.co.uk
nbcmhl.ca nbcmhl.ca
nbfoa.ca nbfoa.ca
netknots.com netknots.com
newsarama.com newsarama.com
nflspinzone.com nflspinzone.com
nhregister.com nhregister.com
niadd.com niadd.com
nlva.net nlva.net
oglecountylife.com oglecountylife.com
ohiogamefishing.com ohiogamefishing.com
onlymyhealth.com onlymyhealth.com
oyenminorhockey.com oyenminorhockey.com
pelicandebrief.com pelicandebrief.com
pinedaleroundup.com pinedaleroundup.com
pippenainteasy.com pippenainteasy.com
pizzabottle.com pizzabottle.com
playingfor90.com playingfor90.com
pngimage.net pngimage.net
powder.com powder.com
predlines.com predlines.com
psneurope.com psneurope.com
puckprose.com puckprose.com
queenofthesouth-mad.co.uk queenofthesouth-mad.co.uk
radaronline.com radaronline.com
rajasthankhabre.com rajasthankhabre.com
razorbackers.com razorbackers.com
rclchallengecup.ca rclchallengecup.ca
readastonvilla.com readastonvilla.com
readburnley.com readburnley.com
readmiddlesbrough.com readmiddlesbrough.com
record-bee.com record-bee.com
redbirdrants.com redbirdrants.com
footymad.net footymad.net
reportingkc.com reportingkc.com
retrogamer.net retrogamer.net
reviewingthebrew.com reviewingthebrew.com
riggosrag.com riggosrag.com
ripcityproject.com ripcityproject.com
risingapple.com risingapple.com
abnormalreturns.com abnormalreturns.com
apptrigger.com apptrigger.com
rmev.cn rmev.cn
rmfhs.ca rmfhs.ca
rochesterrams.org rochesterrams.org
aberystwythleague.co.uk aberystwythleague.co.uk
rollingstone.com rollingstone.com
achahockey.org achahockey.org
acpathletics.com acpathletics.com
actionsportstoday.com actionsportstoday.com
ruathletics.com ruathletics.com
russellvilleathletics.com russellvilleathletics.com
rvathletics.com rvathletics.com
saamtv.com saamtv.com
aciprensa.com aciprensa.com
saladoeaglenation.org saladoeaglenation.org
santacruzsentinel.com santacruzsentinel.com
saskatoonwild.com saskatoonwild.com
savingcountrymusic.com savingcountrymusic.com
sciencealert.com sciencealert.com
scoopduck.com scoopduck.com
scottbulldogs.org scottbulldogs.org
aggieathletics.org aggieathletics.org
secretui.com secretui.com
sebeka-trojans.com sebeka-trojans.com
sedmha.com sedmha.com
sefha.ca sefha.ca
akronnewsreporter.com akronnewsreporter.com
sepiratesathletics.com sepiratesathletics.com
alternateuni.com alternateuni.com
sfasawmill.com sfasawmill.com
shaalaa.com shaalaa.com
allfreesewing.com allfreesewing.com
albumoftheyear.org albumoftheyear.org
sicem365.com sicem365.com
sircharlesincharge.com sircharlesincharge.com
sjraidersathletics.com sjraidersathletics.com
anfieldindex.com anfieldindex.com
anfieldleague.co.uk anfieldleague.co.uk
smnwcougars.com smnwcougars.com
soapoperadigest.com soapoperadigest.com
soaringtoglory.com soaringtoglory.com
sojo1049.com sojo1049.com
sonichits.com sonichits.com
soobluedevils.com soobluedevils.com
southjerseylocalnews.com southjerseylocalnews.com
southsidelynx.com southsidelynx.com
spartanation300.com spartanation300.com
splitsider.com splitsider.com
spnhunters.com spnhunters.com
sportressofblogitude.com sportressofblogitude.com
sportsgrid.com sportsgrid.com
sportsmashup.com sportsmashup.com
sportsradio1250.com sportsradio1250.com
spstallions.com spstallions.com
sputnamathletics.com sputnamathletics.com
staffordshirecsl.co.uk staffordshirecsl.co.uk
arvadawestsports.com arvadawestsports.com
stcharlessports.com stcharlessports.com
1280ksli.com 1280ksli.com
stokecity-mad.co.uk stokecity-mad.co.uk
stormininnorman.com stormininnorman.com
stvmathletics.com stvmathletics.com
suitlandathletics.com suitlandathletics.com
adjfa.org.uk adjfa.org.uk
adnmujer.com.ar adnmujer.com.ar
summerfieldathletics.com summerfieldathletics.com
afflfootball.com afflfootball.com
super9.org super9.org
alt1057albany.com alt1057albany.com
swagvilla.com swagvilla.com
swanseacity-mad.co.uk swanseacity-mad.co.uk
swarmandsting.com swarmandsting.com
svcardinals.com svcardinals.com
svhsathletics.org svhsathletics.org
svmhl.ca svmhl.ca
syracusetitansstrong.com syracusetitansstrong.com
taftathletics.com taftathletics.com
taftraiderathletics.com taftraiderathletics.com
atascaderonews.com atascaderonews.com
taylortitansathletics.com taylortitansathletics.com
atlasetut.com atlasetut.com
tctrojanpride.com tctrojanpride.com
tecumsehathletics.com tecumsehathletics.com
telva.com telva.com
templetonlife.com templetonlife.com
texags.com texags.com
avilabeachlifenews.com avilabeachlifenews.com
tfln.co tfln.co
awimb.com awimb.com
aynorbluejackets.net aynorbluejackets.net
theclemsoninsider.com theclemsoninsider.com
theclintonjournal.com theclintonjournal.com
therockofrochester.com therockofrochester.com
thevikingage.com thevikingage.com
ballparksofbaseball.com ballparksofbaseball.com
thsathletics.org thsathletics.org
tigardtigers.com tigardtigers.com
tigerbait.com tigerbait.com
tips-and-tricks.co tips-and-tricks.co
tiptonathletics.com tiptonathletics.com
tlhannasports.com tlhannasports.com
bathcountyathletics.com bathcountyathletics.com
baycitywesternathletics.com baycitywesternathletics.com
topclassactions.com topclassactions.com
total49ers.com total49ers.com
totalavalanche.com totalavalanche.com
totalbig12.com totalbig12.com
totalblackhawks.com totalblackhawks.com
totalbluejays.com totalbluejays.com
totalbulls.com totalbulls.com
totaldallascowboys.com totaldallascowboys.com
totaldevils.com totaldevils.com
totalducks.com totalducks.com
totalhawks.com totalhawks.com
totalminnesotawild.com totalminnesotawild.com
totalmonarchs.com totalmonarchs.com
totalredsox.com totalredsox.com
totalredwings.com totalredwings.com
totalsox.com totalsox.com
totalutahjazz.com totalutahjazz.com
beedzp.com beedzp.com
trojanpride.net trojanpride.net
tsmguestwriters.com tsmguestwriters.com
besthealthmag.ca besthealthmag.ca
tutsmake.com tutsmake.com
tvhsgoldenbearathletics.com tvhsgoldenbearathletics.com
tvmaze.com tvmaze.com
tvseriesfinale.com tvseriesfinale.com
twolvesathletics.com twolvesathletics.com
ucityathletics.com ucityathletics.com
bglancers.com bglancers.com
uhstitansathletics.com uhstitansathletics.com
bhssports.com bhssports.com
ultimatemetallica.com ultimatemetallica.com
uncached.com uncached.com
uni-watch.com uni-watch.com
uprepathletics.net uprepathletics.net
uptotheminutemen.com uptotheminutemen.com
usssalive.com usssalive.com
usweekly.world usweekly.world
vandaliabutlerathletics.com vandaliabutlerathletics.com
bladesofteal.com bladesofteal.com
blic.rs blic.rs
vfathletics.com vfathletics.com
victorybellrings.com victorybellrings.com
vidaprimo.com vidaprimo.com
vidmax.com vidmax.com
voicenews.com voicenews.com
vrwolvesathletics.com vrwolvesathletics.com
waggenerathletics.com waggenerathletics.com
waldronathletics.com waldronathletics.com
wammnation.com wammnation.com
wapahaniathletics.com wapahaniathletics.com
wasatchhighathletics.com wasatchhighathletics.com
wbathletics.org wbathletics.org
wcyy.com wcyy.com
wcsramsathletics.com wcsramsathletics.com
wauseonsports.org wauseonsports.org
waynedaleathletics.com waynedaleathletics.com
waynedupree.com waynedupree.com
bouldercityathletics.com bouldercityathletics.com
weareauburndaleathletics.com weareauburndaleathletics.com
weartesters.com weartesters.com
wdbqam.com wdbqam.com
wdhifm.com wdhifm.com
weldcentralrebels.com weldcentralrebels.com
brewersfriend.com brewersfriend.com
bridgendanddistrictsfl.co.uk bridgendanddistrictsfl.co.uk
westashleyathletics.org westashleyathletics.org
wghathletics.org wghathletics.org
wgrd.com wgrd.com
wfaa.com wfaa.com
wheatfieldblades.com wheatfieldblades.com
brooklynvegan.com brooklynvegan.com
winamacathletics.com winamacathletics.com
winsloecharlottetownfc.ca winsloecharlottetownfc.ca
wizofawes.com wizofawes.com
wlalacrosse.com wlalacrosse.com
wlathletics.com wlathletics.com
wmcsports.org wmcsports.org
wnbf.com wnbf.com
wnhsathletics.com wnhsathletics.com
bumblebeenation.com bumblebeenation.com
womiowensboro.com womiowensboro.com
woodburnbulldogs.com woodburnbulldogs.com
woodhavenathletics.com woodhavenathletics.com
burlingameathletics.com burlingameathletics.com
worldometers.info worldometers.info
wossmanwildcatsathletics.com wossmanwildcatsathletics.com
wowinterface.com wowinterface.com
wrrv.com wrrv.com
wtbdfm.com wtbdfm.com
wuhanshengqiao.com wuhanshengqiao.com
wtol.com wtol.com
bvathletics.net bvathletics.net
byfa.ca byfa.ca
cacavaliers.com cacavaliers.com
wythemaroons.org wythemaroons.org
cajathletics.com cajathletics.com
xeniaathletics.com xeniaathletics.com
calgaryroyalsaa.com calgaryroyalsaa.com
xlcountry.com xlcountry.com
gunnathletics.com gunnathletics.com
xxiuw.com xxiuw.com
xxlmag.com xxlmag.com
canyonathletics.org canyonathletics.org
yeoviltown-mad.co.uk yeoviltown-mad.co.uk
ygoprodeck.com ygoprodeck.com
catcountry1029.com catcountry1029.com
cbs8.com cbs8.com
cccsathletics.com cccsathletics.com
cedargroveathletics.com cedargroveathletics.com
zeelandeastsports.com zeelandeastsports.com
celebrityborn.com celebrityborn.com
celebrityz.xyz celebrityz.xyz
centervilleelkathletics.com centervilleelkathletics.com
am.com.mx am.com.mx
rt.com rt.com
chschieftains.com chschieftains.com
chscoyotes.org chscoyotes.org
chsreddevils.com chsreddevils.com
chswarriors.org chswarriors.org
ciceroprepathletics.com ciceroprepathletics.com
classicrock1051.com classicrock1051.com
classicrock961.com classicrock961.com
clonesconfidential.com clonesconfidential.com
clumberpark.cc clumberpark.cc
clyde-mad.co.uk clyde-mad.co.uk
coco7.online coco7.online
comicsalliance.com comicsalliance.com
craftpaperscissors.com craftpaperscissors.com
crash.net crash.net
creativeplanetnetwork.com creativeplanetnetwork.com
crockathletics.com crockathletics.com
crossingbroad.com crossingbroad.com
crriverhawks.com crriverhawks.com
culinarykitchenchicago.com culinarykitchenchicago.com
cvathletics.org cvathletics.org
cwncathletics.org cwncathletics.org
cyanogenmods.org cyanogenmods.org
dailynews.com dailynews.com
dalevillesports.com dalevillesports.com
darientimes.com darientimes.com
dchawks.com dchawks.com
dctigersathletics.com dctigersathletics.com
delcotimes.com delcotimes.com
derbyathletics.com derbyathletics.com
dewittathletics.com dewittathletics.com
dewtour.com dewtour.com
dfa-ifleague.co.uk dfa-ifleague.co.uk
dhswildcatnation.com dhswildcatnation.com
djcup.ca djcup.ca
dlmha.ca dlmha.ca
dobberprospects.com dobberprospects.com
dpsdunbarathletics.com dpsdunbarathletics.com
dramha.com dramha.com
dundeerugby.co.uk dundeerugby.co.uk
durhamwestjr.com durhamwestjr.com
eastfife-mad.co.uk eastfife-mad.co.uk
ecvbraves.com ecvbraves.com
edhspanthers.com edhspanthers.com
ehhsathletics.com ehhsathletics.com
eldeber.com.bo eldeber.com.bo
eldeber.pro eldeber.pro
elecodiario.mobi elecodiario.mobi
elginwildcatathletics.com elginwildcatathletics.com
eltoroathletics.com eltoroathletics.com
elyriaathletics.org elyriaathletics.org
emeraldathletics.com emeraldathletics.com
energytv.es energytv.es
eplfootballmatch.com eplfootballmatch.com
esportsgags.com esportsgags.com
evansvilleharrisonathletics.com evansvilleharrisonathletics.com
exetercity-mad.co.uk exetercity-mad.co.uk
fadeawayworld.com fadeawayworld.com
fanspeak.com fanspeak.com
fantasyrundown.com fantasyrundown.com
fascinately.com fascinately.com
favehealthyrecipes.com favehealthyrecipes.com
fayettevilleathletics.com fayettevilleathletics.com
fearthestingihs.org fearthestingihs.org
fgrirish.com fgrirish.com
fhsindians.com fhsindians.com
fhswildcats.com fhswildcats.com
fitness-singles.com fitness-singles.com
foleyathletics.com foleyathletics.com
footballtransfertavern.com footballtransfertavern.com
forumblueandgold.com forumblueandgold.com
fulham-mad.co.uk fulham-mad.co.uk
fulltimefantasy.com fulltimefantasy.com
futbolmundial.com futbolmundial.com
gainesvilleredelephantathletics.com gainesvilleredelephantathletics.com
ganeshagiantsathletics.com ganeshagiantsathletics.com
gardeningknowhow.com gardeningknowhow.com
garnetandcocky.com garnetandcocky.com
gateshead-fc.com gateshead-fc.com
gavitathletics.com gavitathletics.com
gaylordathletics.com gaylordathletics.com
gbmwolverine.com gbmwolverine.com
gchsgreyhounds.com gchsgreyhounds.com
geauxbulldogs.com geauxbulldogs.com
gechnas.ru gechnas.ru
geeksmate.io geeksmate.io
georgetakei.com georgetakei.com
mhs-mavericks.com mhs-mavericks.com
ghathletics.org ghathletics.org
ghsvikings.com ghsvikings.com
girardindians.org girardindians.org
gjhssports.com gjhssports.com
glasgowcollegesfa.co.uk glasgowcollegesfa.co.uk
glencoeathletics.com glencoeathletics.com
glynncountyathletics.com glynncountyathletics.com
gmtoday.com gmtoday.com
goaustinhighathletics.com goaustinhighathletics.com
goballardbruins.com goballardbruins.com
gocentennialathletics.com gocentennialathletics.com
gocometsathletics.com gocometsathletics.com
goeastmark.com goeastmark.com
goghsreddevils.com goghsreddevils.com
gohebronathletics.com gohebronathletics.com
goheightsbulldogs.com goheightsbulldogs.com
gohutchathletics.com gohutchathletics.com
gojoebruin.com gojoebruin.com
golancerssports.com golancerssports.com
goldderby.com goldderby.com
goldenskate.com goldenskate.com
gomarshallredhawks.com gomarshallredhawks.com
gomeritknights.com gomeritknights.com
gomilbybuffs.com gomilbybuffs.com
gondolierathletics.com gondolierathletics.com
gonmbchiefs.com gonmbchiefs.com
gonwtigers.com gonwtigers.com
gopatriotpride.com gopatriotpride.com
gophhsathletics.com gophhsathletics.com
goramsathletics.com goramsathletics.com
gorangerathletics.com gorangerathletics.com
goschscougars.com goschscougars.com
goscorpionsports.com goscorpionsports.com
goshermanbearcats.com goshermanbearcats.com
gouctigers.com gouctigers.com
gowildcatsports.com gowildcatsports.com
grcathletics.com grcathletics.com
greatheartsmontevistaathletics.org greatheartsmontevistaathletics.org
guiaturista.com.ar guiaturista.com.ar
guyerwildcats.com guyerwildcats.com
halewoodsummerleague2019.co.uk halewoodsummerleague2019.co.uk
halohangout.com halohangout.com
hamiltonminorhockey.com hamiltonminorhockey.com
hawkathletics.net hawkathletics.net
hdbeachcams.com hdbeachcams.com
hdkoora.com hdkoora.com
headcramp.com headcramp.com
helloabilene.com helloabilene.com
helloadrian.com helloadrian.com
helloagourahills.com helloagourahills.com
helloamericanfork.com helloamericanfork.com
helloasheboro.com helloasheboro.com
hellobartlesville.com hellobartlesville.com
hellobath.com hellobath.com
hellobelfast.com hellobelfast.com
hellobenin.com hellobenin.com
hellobinghamton.com hellobinghamton.com
hellobogalusa.com hellobogalusa.com
hellocasper.com hellocasper.com
hellochristiansburg.com hellochristiansburg.com
helloclaremore.com helloclaremore.com
helloclarksville.com helloclarksville.com
helloconroe.com helloconroe.com
helloconway.com helloconway.com
hellocorsicana.com hellocorsicana.com
hellocrystallake.com hellocrystallake.com
hellodouglasville.com hellodouglasville.com
hellodubuque.com hellodubuque.com
helloeaglemountain.com helloeaglemountain.com
helloeauclaire.com helloeauclaire.com
helloelcajon.com helloelcajon.com
helloenterprise.com helloenterprise.com
hellofergusfalls.com hellofergusfalls.com
hellofinland.com hellofinland.com
helloflorissant.com helloflorissant.com
hellofoster.com hellofoster.com
hellogastonia.com hellogastonia.com
helloglensfalls.com helloglensfalls.com
hellogulfport.com hellogulfport.com
helloharare.com helloharare.com
helloharrison.com helloharrison.com
hellohayden.com hellohayden.com
hellohays.com hellohays.com
helloinglewood.com helloinglewood.com
hellojanesville.com hellojanesville.com
hellokankakee.com hellokankakee.com
hellokenosha.com hellokenosha.com
hellolackawanna.com hellolackawanna.com
hellolacrosse.com hellolacrosse.com
hellolargo.com hellolargo.com
hellolarochelle.com hellolarochelle.com
hellolaurel.com hellolaurel.com
hellolocal.com hellolocal.com
hellomankato.com hellomankato.com
hellomaplegrove.com hellomaplegrove.com
hellomaplewood.com hellomaplewood.com
hellomarquette.com hellomarquette.com
hellomartinique.com hellomartinique.com
hellomason.com hellomason.com
hellomiamigardens.com hellomiamigardens.com
hellomineralwells.com hellomineralwells.com
hellomonterey.com hellomonterey.com
hellomontpellier.com hellomontpellier.com
hellomountainhome.com hellomountainhome.com
hellomountlaketerrace.com hellomountlaketerrace.com
hellonatchitoches.com hellonatchitoches.com
hellonational.com hellonational.com
hellonewbern.com hellonewbern.com
hellonewbraunfels.com hellonewbraunfels.com
hellonewphiladelphia.com hellonewphiladelphia.com
hellonewrochelle.com hellonewrochelle.com
helloniagarafalls.com helloniagarafalls.com
hellonottingham.com hellonottingham.com
hellooakparkvillage.com hellooakparkvillage.com
helloocoee.com helloocoee.com
helloowasso.com helloowasso.com
hellopasorobles.com hellopasorobles.com
hellopewaukee.com hellopewaukee.com
hellopleasanton.com hellopleasanton.com
helloportlandmaine.com helloportlandmaine.com
hellopoughkeepsie.com hellopoughkeepsie.com
helloprairie.com helloprairie.com
hellorichland.com hellorichland.com
hellorocklin.com hellorocklin.com
hellosaintbarts.com hellosaintbarts.com
hellosantamonica.com hellosantamonica.com
hellosaudiarabia.com hellosaudiarabia.com
hellosouthlake.com hellosouthlake.com
hellotasmania.com hellotasmania.com
helloturkey.com helloturkey.com
hellounitedarabemirates.com hellounitedarabemirates.com
hellovacaville.com hellovacaville.com
helloventura.com helloventura.com
hellovineland.com hellovineland.com
hellowashougal.com hellowashougal.com
hellowaterbury.com hellowaterbury.com
helloweatherford.com helloweatherford.com
hellowilliamsburg.com hellowilliamsburg.com
hellowilloughby.com hellowilloughby.com
hellowinchester.com hellowinchester.com
hellowoodward.com hellowoodward.com
helloyuccavalley.com helloyuccavalley.com
helloyuma.com helloyuma.com
heraldathletics.com heraldathletics.com
hfathletics.com hfathletics.com
hhspatriots.org hhspatriots.org
hillsboroathletics.org hillsboroathletics.org
hitchcockbulldogs.org hitchcockbulldogs.org
hockeydb.com hockeydb.com
jrhsathletics.com jrhsathletics.com
hotspurhq.com hotspurhq.com
hoy.com.ni hoy.com.ni
hudsonexplorersathletics.com hudsonexplorersathletics.com
huntsvillehavoc.com huntsvillehavoc.com
hurontigerathletics.com hurontigerathletics.com
hvlathletics.com hvlathletics.com
iceboltztournament.com iceboltztournament.com
inquisitr.com inquisitr.com
islanderathletics.com islanderathletics.com
italiaflyers.com italiaflyers.com
itsfoss.com itsfoss.com
jagran.com jagran.com
jasperathletics.com jasperathletics.com
jenisonathletics.com jenisonathletics.com
jetlaggin.com jetlaggin.com
johnmarshallathletics.com johnmarshallathletics.com
joneshighathletics.com joneshighathletics.com
joshreads.com joshreads.com
jourdantonathletics.com jourdantonathletics.com
journal-advocate.com journal-advocate.com
jvhsjaguars.com jvhsjaguars.com
kardashiandish.com kardashiandish.com
kcbsnewsradio.com kcbsnewsradio.com
kearnykomets.com kearnykomets.com
kfmx.com kfmx.com
kgab.com kgab.com
kgw.com kgw.com
killthecablebill.com killthecablebill.com
kipptexas-sanantonioathletics.com kipptexas-sanantonioathletics.com
klyq.com klyq.com
kmmountaineers.com kmmountaineers.com
kneehillminorhockey.ca kneehillminorhockey.ca
knighthawksathletics.com knighthawksathletics.com
knightsathletics.net knightsathletics.net
knowledgedish.com knowledgedish.com
kool1017.com kool1017.com
kotaku.co.uk kotaku.co.uk
krem.com krem.com
ksjcathletics.com ksjcathletics.com
kvue.com kvue.com
kxrb.com kxrb.com
lajkar.se lajkar.se
lasalleprepathletics.org lasalleprepathletics.org
lbpolyathletics.com lbpolyathletics.com
leedavisathletics.com leedavisathletics.com
leegeneralsathletics.com leegeneralsathletics.com
lehiathletics.com lehiathletics.com
leicestercity-mad.co.uk leicestercity-mad.co.uk
letrasweb.com.br letrasweb.com.br
lghsathletics.com lghsathletics.com
lincolnprepathletics.com lincolnprepathletics.com
liteonline.com liteonline.com
logopond.com logopond.com
lonestar995fm.com lonestar995fm.com
losaltosathletics.org losaltosathletics.org
losaltossports.com losaltossports.com
lotrointerface.com lotrointerface.com
loudwiremusicfestival.com loudwiremusicfestival.com
lrathletics.org lrathletics.org
luathletics.org luathletics.org
maraudersathletics.com maraudersathletics.com
marinij.com marinij.com
matadorathletics.org matadorathletics.org
matchendirect.fr matchendirect.fr
mbbuccaneers.com mbbuccaneers.com
mcaathletics.com mcaathletics.com
mcamustangsathletics.org mcamustangsathletics.org
mckinleyathletics.org mckinleyathletics.org
meadowbrookathletics.com meadowbrookathletics.com
medinaathletics.com medinaathletics.com
memorialhsathletics.com memorialhsathletics.com
menscrown.com menscrown.com
metsmerizedonline.com metsmerizedonline.com
mix949.com mix949.com
mjsportszone.com mjsportszone.com
mmatorch.com mmatorch.com
momspresso.com momspresso.com
monctonminorbaseball.ca monctonminorbaseball.ca
mountainhouseathletics.com mountainhouseathletics.com
mqtathletics.com mqtathletics.com
musipedia.org musipedia.org
musketeersathletics.com musketeersathletics.com
mvjaguars.com mvjaguars.com
mwhswildcats.com mwhswildcats.com
myb106.com myb106.com
mymmanews.com mymmanews.com
naeagles.com naeagles.com
naibuzz.com naibuzz.com
nationalenquirer.com nationalenquirer.com
ncaagamesim.com ncaagamesim.com
nchsathletics.com nchsathletics.com
ncwhsathletics.com ncwhsathletics.com
newschoolers.com newschoolers.com
nhseagleathletics.com nhseagleathletics.com
nihl.net nihl.net
njbeachcams.com njbeachcams.com
nlaeagles.org nlaeagles.org
nohsathletics.com nohsathletics.com
northfieldathletics.com northfieldathletics.com
northwestathletics.org northwestathletics.org
nsjhl.ca nsjhl.ca
nssll.ca nssll.ca
nswings.net nswings.net
nuviewbridgeathletics.com nuviewbridgeathletics.com
oaathletics.org oaathletics.org
oakmountainathletics.org oakmountainathletics.org
oakridgeathletics.com oakridgeathletics.com
ohslions.com ohslions.com
okanaganathletics.ca okanaganathletics.ca
olaathletics.com olaathletics.com
oldmillathletics.com oldmillathletics.com
ooltewahathletics.com ooltewahathletics.com
oregoncityschoolsathletics.org oregoncityschoolsathletics.org
oremhighathletics.com oremhighathletics.com
osoyoosdesertclassic.com osoyoosdesertclassic.com
owlsathletics.org owlsathletics.org
pacerathletics.org pacerathletics.org
pasoroblespress.com pasoroblespress.com
patriotproud.net patriotproud.net
rebelstrue.com rebelstrue.com
petapixel.com petapixel.com
phhspatriotpride.com phhspatriotpride.com
phinphanatic.com phinphanatic.com
phnhuskies.com phnhuskies.com
phoenixvillenews.com phoenixvillenews.com
phpatriots.net phpatriots.net
phswarriors.com phswarriors.com
piedmontwildcatsathletics.com piedmontwildcatsathletics.com
pikesvilleathletics.com pikesvilleathletics.com
piquaindiansathletics.org piquaindiansathletics.org
piratesnation.org piratesnation.org
pleasantgrovevikings.com pleasantgrovevikings.com
pmhsfalcons.com pmhsfalcons.com
ponyfans.com ponyfans.com
popeathletics.com popeathletics.com
prepvolleyball.com prepvolleyball.com
prowrestling.com prowrestling.com
prowrestling.net prowrestling.net
pucksandpitchforks.com pucksandpitchforks.com
pvtimes.com pvtimes.com
pwinsider.com pwinsider.com
qchsathletics.com qchsathletics.com
questionablecontent.net questionablecontent.net
quizpeek.com quizpeek.com
redbankathletics.com redbankathletics.com
reeserocketsathletics.com reeserocketsathletics.com
register-pajaronian.com register-pajaronian.com
reviewjournal.com reviewjournal.com
ridgehockey.net ridgehockey.net
ringgoldrams.org ringgoldrams.org
ritenourathletics.com ritenourathletics.com
river967.com river967.com
riverbluffathletics.com riverbluffathletics.com
arcadeprehacks.com arcadeprehacks.com
abilenecooperathletics.org abilenecooperathletics.org
rochellenews-leader.com rochellenews-leader.com
rock1029.com rock1029.com
romagladiatornation.com romagladiatornation.com
rpp.pe rpp.pe
rsvponline.mx rsvponline.mx
rubbingtherock.com rubbingtherock.com
rugby365.com rugby365.com
rugbyclub9.be rugbyclub9.be
areavibes.com areavibes.com
russbk.com russbk.com
rvblazerathletics.com rvblazerathletics.com
sabrehockey.com sabrehockey.com
sacnilk.com sacnilk.com
saddlebackathletics.com saddlebackathletics.com
salinehornets.com salinehornets.com
arhlhockey.com arhlhockey.com
sanjuan8.com sanjuan8.com
saxonathletics.com saxonathletics.com
afyfc.co.uk afyfc.co.uk
scacchoops.com scacchoops.com
scarletandgame.com scarletandgame.com
scbuffalostrong.com scbuffalostrong.com
sdcavers.com sdcavers.com
seagullsbaseballacademy.com seagullsbaseballacademy.com
ahsathletics.com ahsathletics.com
ahsindians.com ahsindians.com
ahsrocketsports.org ahsrocketsports.org
sentinelandenterprise.com sentinelandenterprise.com
sequoyahathletics.com sequoyahathletics.com
seqsports.com seqsports.com
seventyfirstathletics.com seventyfirstathletics.com
alohaathletics.org alohaathletics.org
sgcathletics.com sgcathletics.com
seymourathletics.com seymourathletics.com
sfgate.com sfgate.com
aroyalpain.com aroyalpain.com
shediacminorhockey.com shediacminorhockey.com
sheltonherald.com sheltonherald.com
allhiphop.com allhiphop.com
algonabulldogs.org algonabulldogs.org
shoresportsnetwork.com shoresportsnetwork.com
shs-falcons.com shs-falcons.com
shswolfpack.com shswolfpack.com
amhsraptors.com amhsraptors.com
sinembargo.mx sinembargo.mx
amcg.cn amcg.cn
skyscraperblues.com skyscraperblues.com
slapthesign.com slapthesign.com
slcavaliers.com slcavaliers.com
anthemprepathletics.com anthemprepathletics.com
sneakhype.com sneakhype.com
snapguide.com snapguide.com
smpanthersports.com smpanthersports.com
angelswin-forum.com angelswin-forum.com
socasteeathletics.com socasteeathletics.com
soddydaisyathletics.com soddydaisyathletics.com
sofeminine.co.uk sofeminine.co.uk
antonymsfor.com antonymsfor.com
somehow.world somehow.world
sooball.com sooball.com
soundersnation.com soundersnation.com
soycarmin.pro soycarmin.pro
southceredigionjfl.co.uk southceredigionjfl.co.uk
southernchestercountyweeklies.com southernchestercountyweeklies.com
aplusknightsathletics.com aplusknightsathletics.com
spectorshockey.net spectorshockey.net
spiritofboise.com spiritofboise.com
sprmha.com sprmha.com
arundelathletics.com arundelathletics.com
014358.com 014358.com
014490.com 014490.com
014546.com 014546.com
starsandsticks.com starsandsticks.com
starcrush.com starcrush.com
stcathletics.com stcathletics.com
1027kord.com 1027kord.com
1045theteam.com 1045theteam.com
1130thetiger.com 1130thetiger.com
12newsnow.com 12newsnow.com
13newsnow.com 13newsnow.com
1470kyyw.com 1470kyyw.com
abc10.com abc10.com
acceptthisrose.com acceptthisrose.com
acidcow.com acidcow.com
surfline.com surfline.com
surfturfandmurph.com surfturfandmurph.com
allfreeknitting.com allfreeknitting.com
sweetslyrics.com sweetslyrics.com
amherstfc.co.uk amherstfc.co.uk
swantonathletics.org swantonathletics.org
swraidersathletics.com swraidersathletics.com
swtorui.com swtorui.com
swwgl.co.uk swwgl.co.uk
animalgourmet.com animalgourmet.com
tabascohoy.com tabascohoy.com
tabcrawler.com tabcrawler.com
tbrnews.com tbrnews.com
tcrams.net tcrams.net
techbulldogs.com techbulldogs.com
tephockey.com tephockey.com
avonworthathletics.com avonworthathletics.com
thatballsouttahere.com thatballsouttahere.com
ayrshireschoolsfa.co.uk ayrshireschoolsfa.co.uk
thegameraccess.com thegameraccess.com
thenewsherald.com thenewsherald.com
theridgefieldpress.com theridgefieldpress.com
thesmokingcuban.com thesmokingcuban.com
thetelegraph.com thetelegraph.com
thomasdaleathletics.com thomasdaleathletics.com
theyucatantimes.com theyucatantimes.com
thibodauxtigers.org thibodauxtigers.org
banana1015.com banana1015.com
thsouthsports.com thsouthsports.com
thunderathletics.org thunderathletics.org
ticehurstfc.co.uk ticehurstfc.co.uk
timbercreekathletics.com timbercreekathletics.com
baratacademyathletics.org baratacademyathletics.org
tipofthetower.com tipofthetower.com
tippecanoeathletics.com tippecanoeathletics.com
timescall.com timescall.com
titansathletics.org titansathletics.org
tjpatriotathletics.com tjpatriotathletics.com
tohsathletics.org tohsathletics.org
bchighbearcats.com bchighbearcats.com
bchsdolphins.com bchsdolphins.com
total911.com total911.com
totalbengals.com totalbengals.com
totalceltics.com totalceltics.com
totalchiefs.com totalchiefs.com
totalcubs.com totalcubs.com
totaldenverbroncos.com totaldenverbroncos.com
totalduke.com totalduke.com
totalmapleleafs.com totalmapleleafs.com
totalillini.com totalillini.com
totalindy.com totalindy.com
beargoggleson.com beargoggleson.com
totalmiamiheat.com totalmiamiheat.com
totalpac12.com totalpac12.com
trabzonilkadimgayrimenkul.com trabzonilkadimgayrimenkul.com
beechgrove-athletics.com beechgrove-athletics.com
beldingathletics.com beldingathletics.com
tri-centraltrojans.com tri-centraltrojans.com
tri-countyathletics.com tri-countyathletics.com
bemad.es bemad.es
troyrecord.com troyrecord.com
truckerscafefood4soul.org truckerscafefood4soul.org
tscougarssports.com tscougarssports.com
bernieburkegolf.ca bernieburkegolf.ca
tuningcult.com tuningcult.com
tvnewz.xyz tvnewz.xyz
twobillsdrive.com twobillsdrive.com
uancx15.com uancx15.com
bexleyathletics.com bexleyathletics.com
bghsathletics.com bghsathletics.com
bigblueinteractive.com bigblueinteractive.com
bigcountry969.com bigcountry969.com
uovmhl.ca uovmhl.ca
urbanahawksathletics.com urbanahawksathletics.com
uscreditcardguide.com uscreditcardguide.com
uscscoop.com uscscoop.com
utvsl.co.uk utvsl.co.uk
bishopenglandathletics.com bishopenglandathletics.com
valleyviewtigers1.com valleyviewtigers1.com
vasjvikings.com vasjvikings.com
veintitantos.com veintitantos.com
viralcuba.com viralcuba.com
bluefm.com.ar bluefm.com.ar
blythewoodbengals.com blythewoodbengals.com
vmsa.ca vmsa.ca
volleyballpei.com volleyballpei.com
bnwr.ca bnwr.ca
boardmanathletics.org boardmanathletics.org
bobjonesathletics.com bobjonesathletics.com
volnation.com volnation.com
vtvgujarati.com vtvgujarati.com
boldsky.com boldsky.com
vulture.com vulture.com
boltbeat.com boltbeat.com
wabashapaches.net wabashapaches.net
bongino.com bongino.com
bosseathletics.com bosseathletics.com
wbrz.com wbrz.com
wchseagles.com wchseagles.com
wchshl.com wchshl.com
wcnc.com wcnc.com
wdea.am wdea.am
bowmanathletics.org bowmanathletics.org
wearebeggs.com wearebeggs.com
wearenorco.org wearenorco.org
wearesc.com wearesc.com
boxelderathletics.com boxelderathletics.com
weselleldorado.com weselleldorado.com
wfgr.com wfgr.com
wfmynews2.com wfmynews2.com
wfnt.com wfnt.com
wforum.com wforum.com
wgna.com wgna.com
whas11.com whas11.com
broadneckathletics.org broadneckathletics.org
broadstreetbuzz.com broadstreetbuzz.com
brockeaglesathletics.com brockeaglesathletics.com
widefieldgladiators.org widefieldgladiators.org
wideopencountry.com wideopencountry.com
whoabella.com whoabella.com
whspanthers.com whspanthers.com
brushnewstribune.com brushnewstribune.com
brvathletics.com brvathletics.com
btwathletics.com btwathletics.com
buccaneerstrong.com buccaneerstrong.com
buckslocalnews.com buckslocalnews.com
winteriscoming.net winteriscoming.net
wkfr.com wkfr.com
wkmi.com wkmi.com
wlvfl.co.uk wlvfl.co.uk
wobm.com wobm.com
wopanthers.com wopanthers.com
wowkeren.com wowkeren.com
wpst.com wpst.com
buttscountyathletics.com buttscountyathletics.com
wtsp.com wtsp.com
wusa9.com wusa9.com
bvayouthsoccer.com bvayouthsoccer.com
bwha.ca bwha.ca
wwfoldschool.com wwfoldschool.com
wykewanderers.com wykewanderers.com
cafepharma.com cafepharma.com
caffeineinformer.com caffeineinformer.com
cajoncowboyathletics.com cajoncowboyathletics.com
xiehui.org xiehui.org
hailwv.com hailwv.com
yanksgoyard.com yanksgoyard.com
yoamoloszapatos.com yoamoloszapatos.com
yovizag.com yovizag.com
catcountry1073.com catcountry1073.com
yucatan.com.mx yucatan.com.mx
cavsathletics.com cavsathletics.com
cekingathletics.com cekingathletics.com
celebbabylaundry.com celebbabylaundry.com
zeelandwestsports.com zeelandwestsports.com
centralscotlandfa.co.uk centralscotlandfa.co.uk
centralscottishafl.co.uk centralscottishafl.co.uk
cfcolts.com cfcolts.com
cgbulldogs.com cgbulldogs.com
cheapism.com cheapism.com
chhuskies.com chhuskies.com
chopchat.com chopchat.com
chowderandchampions.com chowderandchampions.com
pe.com pe.com
chsfalconpride.com chsfalconpride.com
chsfalcons.com chsfalcons.com
chslionsathletics.com chslionsathletics.com
clarets-mad.co.uk clarets-mad.co.uk
climbingtalshill.com climbingtalshill.com
cmaspartans.com cmaspartans.com
cmh4444.com cmh4444.com
cnynews.com cnynews.com
collegegridirons.com collegegridirons.com
cool987fm.com cool987fm.com
cordcuttersnews.com cordcuttersnews.com
coventryathletics.org coventryathletics.org
covers.com covers.com
covinahighathletics.com covinahighathletics.com
cricketpakistan.com.pk cricketpakistan.com.pk
cronica.com.ar cronica.com.ar
crookanddistrictleague.co.uk crookanddistrictleague.co.uk
csfbl.com csfbl.com
csfda.co.uk csfda.co.uk
csnbbs.com csnbbs.com
csskodiaks.com csskodiaks.com
cucharasonica.com cucharasonica.com
cute2w.in cute2w.in
daculaathletics.com daculaathletics.com
dadecountyathletics.com dadecountyathletics.com
dailybreeze.com dailybreeze.com
dailypuppy.com dailypuppy.com
dairygoatinfo.com dairygoatinfo.com
dakotagardenexpo.com dakotagardenexpo.com
damienathletics.com damienathletics.com
dancehallworld.net dancehallworld.net
dawgpounddaily.com dawgpounddaily.com
dawindycity.com dawindycity.com
dbhssports.org dbhssports.org
ddotomen.co ddotomen.co
ddyfa.co.uk ddyfa.co.uk
denmarkathletics.com denmarkathletics.com
denverpost.com denverpost.com
deshtv.in deshtv.in
dfl2009.co.uk dfl2009.co.uk
dhsdragonsathletics.com dhsdragonsathletics.com
dhshsathletics.com dhshsathletics.com
diabloathletics.com diabloathletics.com
dkn.tv dkn.tv
dmwolves.com dmwolves.com
dobberhockey.com dobberhockey.com
dobbersports.com dobbersports.com
dobiepride.com dobiepride.com
dowathletics.com dowathletics.com
dpsbelmontathletics.com dpsbelmontathletics.com
duvalathletics.com duvalathletics.com
dvskyhawksathletics.com dvskyhawksathletics.com
easleyathletics.com easleyathletics.com
eastlansingathletics.com eastlansingathletics.com
eastviewathletics.com eastviewathletics.com
eddiesathletics.com eddiesathletics.com
ehsathletics.org ehsathletics.org
ejeagleathletics.org ejeagleathletics.org
eleconomista.es eleconomista.es
eleconomistaamerica.cl eleconomistaamerica.cl
elkhartblazersports.com elkhartblazersports.com
elmonteathletics.com elmonteathletics.com
embhl.ca embhl.ca
enfieldtownfootballclub.co.uk enfieldtownfootballclub.co.uk
ennislions.org ennislions.org
eqinterface.com eqinterface.com
erhsmustangathletics.com erhsmustangathletics.com
etowahhighathletics.com etowahhighathletics.com
excelsemipro.com excelsemipro.com
excelsior.com.mx excelsior.com.mx
expansion.com expansion.com
factaholics.com factaholics.com
fairbornathletics.com fairbornathletics.com
faktually.com faktually.com
fanbuzz.com fanbuzz.com
fantasyhockeygeek.com fantasyhockeygeek.com
fcflashes.com fcflashes.com
fftoday.com fftoday.com
fftodayforums.com fftodayforums.com
finance101.com finance101.com
fliernation.org fliernation.org
floridaleague.com floridaleague.com
flucoathletics.com flucoathletics.com
fmhsathletics.com fmhsathletics.com
footballfoundation.org footballfoundation.org
forresnairnwfa.co.uk forresnairnwfa.co.uk
fortmorgantimes.com fortmorgantimes.com
fosterfalcons.com fosterfalcons.com
foxcreekathletics.com foxcreekathletics.com
foxiauto.com foxiauto.com
fullertonindiansathletics.com fullertonindiansathletics.com
funattic.com funattic.com
gahannalincolnathletics.com gahannalincolnathletics.com
gahrgladiators.com gahrgladiators.com
gauchosportsproperties.com gauchosportsproperties.com
gbhsathletics.com gbhsathletics.com
gcaathletics.org gcaathletics.org
gchsathletics.org gchsathletics.org
geekycamel.com geekycamel.com
geoguessr.com geoguessr.com
ghsathletics.com ghsathletics.com
gigemgazette.com gigemgazette.com
gilbertathletics.org gilbertathletics.org
givemeasecond.com givemeasecond.com
gladewaterathletics.com gladewaterathletics.com
glendoraathletics.com glendoraathletics.com
goaliepost.com goaliepost.com
gobluedevilsports.com gobluedevilsports.com
gocomets.net gocomets.net
gocrusadersathletics.com gocrusadersathletics.com
godwinheightsathletics.com godwinheightsathletics.com
goeatoneagles.com goeatoneagles.com
gofcswarriors.com gofcswarriors.com
golargolions.com golargolions.com
golfmagic.com golfmagic.com
golfweek.com golfweek.com
gon.com gon.com
gonewalbany.com gonewalbany.com
gonwpanthers.com gonwpanthers.com
gool24.net gool24.net
gopolarbears.com gopolarbears.com
gorattlernation.com gorattlernation.com
gosparkplugs.com gosparkplugs.com
gotaftathletics.com gotaftathletics.com
gotfhsbruins.com gotfhsbruins.com
govalleyvikings.com govalleyvikings.com
gowilsonwildcats.com gowilsonwildcats.com
gowoodbridge.org gowoodbridge.org
gphswildcats.com gphswildcats.com
grchristianeagles.com grchristianeagles.com
greatlakesleague.org greatlakesleague.org
greenbulldogathletics.com greenbulldogathletics.com
griffinbearsathletics.com griffinbearsathletics.com
groceryshopforfreeatthemart.com groceryshopforfreeatthemart.com
gthstitanathletics.com gthstitanathletics.com
hannity.com hannity.com
hcathletics.net hcathletics.net
headphonereview.com headphonereview.com
helloaiken.com helloaiken.com
helloalice.com helloalice.com
helloasheville.com helloasheville.com
helloattleboro.com helloattleboro.com
hellobaraboo.com hellobaraboo.com
hellobarrie.com hellobarrie.com
hellobeatrice.com hellobeatrice.com
hellobelleville.com hellobelleville.com
hellobixby.com hellobixby.com
hellobroadviewheights.com hellobroadviewheights.com
hellobrokenarrow.com hellobrokenarrow.com
hellocentennial.com hellocentennial.com
hellochippewafalls.com hellochippewafalls.com
hellocolonialheights.com hellocolonialheights.com
hellocopperascove.com hellocopperascove.com
hellocoronado.com hellocoronado.com
hellocottonwoodheights.com hellocottonwoodheights.com
hellocountryclubhills.com hellocountryclubhills.com
hellocranston.com hellocranston.com
hellodaphne.com hellodaphne.com
hellodaressalaam.com hellodaressalaam.com
hellodavie.com hellodavie.com
hellodeland.com hellodeland.com
hellodiamondbar.com hellodiamondbar.com
helloeagle.com helloeagle.com
helloemporia.com helloemporia.com
helloengland.com helloengland.com
hellofarmingtonhills.com hellofarmingtonhills.com
hellofortatkinson.com hellofortatkinson.com
hellohammond.com hellohammond.com
hellohickory.com hellohickory.com
hellohopkins.com hellohopkins.com
hellohugo.com hellohugo.com
helloinvergroveheights.com helloinvergroveheights.com
hellojerseyshore.com hellojerseyshore.com
hellokokomo.com hellokokomo.com
hellolagunawoods.com hellolagunawoods.com
hellolascruces.com hellolascruces.com
hellolenoir.com hellolenoir.com
hellolongview.com hellolongview.com
hellomanassas.com hellomanassas.com
hellomeridian.com hellomeridian.com
hellominthill.com hellominthill.com
hellomishawaka.com hellomishawaka.com
hellomurray.com hellomurray.com
hellonetwork.com hellonetwork.com
hellonewberlin.com hellonewberlin.com
hellonorman.com hellonorman.com
hellonorthaugusta.com hellonorthaugusta.com
hellonorthridgeville.com hellonorthridgeville.com
hellonovi.com hellonovi.com
helloolympia.com helloolympia.com
helloorinda.com helloorinda.com
hellopalmbeachgardens.com hellopalmbeachgardens.com
hellopinecrest.com hellopinecrest.com
helloporto.com helloporto.com
hellopullman.com hellopullman.com
hellopuntagorda.com hellopuntagorda.com
helloranchosantamargarita.com helloranchosantamargarita.com
helloreedley.com helloreedley.com
helloreunion.com helloreunion.com
helloriyadh.com helloriyadh.com
hellorockymount.com hellorockymount.com
helloroseburg.com helloroseburg.com
hellorussia.com hellorussia.com
hellosaintkitts.com hellosaintkitts.com
hellosaintlucia.com hellosaintlucia.com
hellosanclemente.com hellosanclemente.com
helloshelby.com helloshelby.com
hellosolomonislands.com hellosolomonislands.com
hellosolomons.com hellosolomons.com
hellosouthjordan.com hellosouthjordan.com
hellosouthpasadena.com hellosouthpasadena.com
hellospringfield.com hellospringfield.com
hellospringville.com hellospringville.com
hellosubraal-haymah.com hellosubraal-haymah.com
hellosunnyside.com hellosunnyside.com
hellotroy.com hellotroy.com
hellotwinfalls.com hellotwinfalls.com
hellotworivers.com hellotworivers.com
helloupland.com helloupland.com
hellowalker.com hellowalker.com
hellowarsaw.com hellowarsaw.com
hellowaukegan.com hellowaukegan.com
hellowausau.com hellowausau.com
hellowestfield.com hellowestfield.com
hellowestmonroe.com hellowestmonroe.com
hellowestvalleycity.com hellowestvalleycity.com
hellowheaton.com hellowheaton.com
hellowhittier.com hellowhittier.com
hellowoburn.com hellowoburn.com
helloxenia.com helloxenia.com
helloyucaipa.com helloyucaipa.com
heraldo.es heraldo.es
herzindagi.com herzindagi.com
heyquiz.com heyquiz.com
hhla.ca hhla.ca
hhpboosterclub.com hhpboosterclub.com
hhshoyasports.com hhshoyasports.com
hidalgopirates.org hidalgopirates.org
higherlevelsportsacademy.com higherlevelsportsacademy.com
hlsdsports.us hlsdsports.us
hmbhsathletics.com hmbhsathletics.com
hokesbluffathletics.com hokesbluffathletics.com
hoosierstateofmind.com hoosierstateofmind.com
hot975fm.com hot975fm.com
houstononthecheap.com houstononthecheap.com
hoverugby.club hoverugby.club
humboldtminorhockey.ca humboldtminorhockey.ca
hunterr.site hunterr.site
huskiesathletics.org huskiesathletics.org
ibtimes.com.au ibtimes.com.au
icehawkshockey.ca icehawkshockey.ca
idabelwarriors.com idabelwarriors.com
ifagrassrootsabc.co.uk ifagrassrootsabc.co.uk
iheartdogs.com iheartdogs.com
ilovemydogsomuch.com ilovemydogsomuch.com
ilwarriors.com ilwarriors.com
inhalesports.com inhalesports.com
ringsidenews.com ringsidenews.com
intouchweekly.com intouchweekly.com
ioniaathletics.com ioniaathletics.com
ironhorseathletics.net ironhorseathletics.net
jamesclemensathletics.com jamesclemensathletics.com
jaysjournal.com jaysjournal.com
jcpantherathletics.org jcpantherathletics.org
jeffathletics.com jeffathletics.com
jeffersonfalconathletics.com jeffersonfalconathletics.com
jetsathletics.org jetsathletics.org
jimrome.com jimrome.com
joblo.com joblo.com
jomustangathletics.com jomustangathletics.com
jonesborocardinals.com jonesborocardinals.com
kalamazooribfest.com kalamazooribfest.com
kayfabenews.com kayfabenews.com
kearnsathletics.com kearnsathletics.com
kekbfm.com kekbfm.com
kellathletics.org kellathletics.org
kempnerathletics.com kempnerathletics.com
kentuckysportsradio.com kentuckysportsradio.com
kicks105.com kicks105.com
kixs.com kixs.com
klaw.com klaw.com
kmhk.com kmhk.com
kmhlhockey.com kmhlhockey.com
kmhsmustangathletics.net kmhsmustangathletics.net
knightnationathletics.com knightnationathletics.com
ktemnews.com ktemnews.com
ktvb.com ktvb.com
lackeyathletics.com lackeyathletics.com
lafayettefightingirish.com lafayettefightingirish.com
lagunahillsathletics.com lagunahillsathletics.com
lakecityathletics.org lakecityathletics.org
lancasterathletics.com lancasterathletics.com
laprensa.com.ni laprensa.com.ni
lawndaleathletics.com lawndaleathletics.com
lawofficer.com lawofficer.com
lecap.net lecap.net
lecathletics.com lecathletics.com
lewiscountyathletics.com lewiscountyathletics.com
lewisfalconsathletics.com lewisfalconsathletics.com
lhathletics.com lhathletics.com
lhshornets.com lhshornets.com
lhslancers.com lhslancers.com
lincolnprepathletics.org lincolnprepathletics.org
lingq.com lingq.com
listindiario.com listindiario.com
livemusicblog.com livemusicblog.com
living101.com living101.com
ljloboathletics.com ljloboathletics.com
loogooteeathletics.com loogooteeathletics.com
losandespass.com.ar losandespass.com.ar
losgatosathletics.com losgatosathletics.com
loudwire.com loudwire.com
lumsdencubs.ca lumsdencubs.ca
lutonrugby.com lutonrugby.com
lwwathletics.com lwwathletics.com
lynbrookathletics.com lynbrookathletics.com
lyricsreg.com lyricsreg.com
macombdaily.com macombdaily.com
manchesterdutchmen.com manchesterdutchmen.com
marketrealist.com marketrealist.com
masfl.co.uk masfl.co.uk
massbaychiefs.com massbaychiefs.com
mavpride.com mavpride.com
mbcaathletics.org mbcaathletics.org
mbdragonathletics.com mbdragonathletics.com
mchiathletics.com mchiathletics.com
mcmustangs.com mcmustangs.com
meadeathletics.com meadeathletics.com
mediotiempo.com mediotiempo.com
meijeraaahockey.com meijeraaahockey.com
merthyrtydfilafl.co.uk merthyrtydfilafl.co.uk
metsminors.net metsminors.net
mitele.es mitele.es
mmhsathletics.com mmhsathletics.com
mmmhl.ca mmmhl.ca
mmorpg.com mmorpg.com
mohawks4life.com mohawks4life.com
montereyherald.com montereyherald.com
moodytrojans.com moodytrojans.com
mostacapital3.com mostacapital3.com
mqtmutineers.com mqtmutineers.com
mrhsathletics.com mrhsathletics.com
mrhsgrizzlies.org mrhsgrizzlies.org
mthfightingowls.com mthfightingowls.com
mtmorrisathletics.com mtmorrisathletics.com
munciecentralathletics.com munciecentralathletics.com
munstermustangs.com munstermustangs.com
myjournalcourier.com myjournalcourier.com
mykhel.com mykhel.com
mysanantonio.com mysanantonio.com
nacionrex.com nacionrex.com
nataliasports.net nataliasports.net
nativeplanet.com nativeplanet.com
nbafullhd.com nbafullhd.com
ncacrusaders.org ncacrusaders.org
ndaeagles.org ndaeagles.org
ndathletics.com ndathletics.com
ndnation.com ndnation.com
neepawaminorhockey.ca neepawaminorhockey.ca
newswest9.com newswest9.com
nflanalysis.net nflanalysis.net
nfldraftdiamonds.com nfldraftdiamonds.com
nghsbulldogs.com nghsbulldogs.com
nibfanational.co.uk nibfanational.co.uk
nickiswift.com nickiswift.com
nisoutherngirlsleague.co.uk nisoutherngirlsleague.co.uk
nmhsathletics.com nmhsathletics.com
nnshshl.com nnshshl.com
npaaathletics.com npaaathletics.com
npcmustangs.com npcmustangs.com
nswildcats.com nswildcats.com
nulltx.com nulltx.com
oberlinathletics.org oberlinathletics.org
oconnellathletics.com oconnellathletics.com
oconnorathletics.com oconnorathletics.com
ohahockey.ca ohahockey.ca
oilerathletics.com oilerathletics.com
okotoksbasketball.ca okotoksbasketball.ca
ole.com.ar ole.com.ar
olentangyberlinathletics.com olentangyberlinathletics.com
red-mammoth.com red-mammoth.com
ondu.ru ondu.ru
oneidadispatch.com oneidadispatch.com
ourcatholicprayers.com ourcatholicprayers.com
ovpatriots.com ovpatriots.com
owhsbruins.com owhsbruins.com
pajiba.com pajiba.com
paladins.guru paladins.guru
pasadenastarnews.com pasadenastarnews.com
pceagles.com pceagles.com
pcepactivities.com pcepactivities.com
pcrathletics.com pcrathletics.com
peifootball.ca peifootball.ca
pelhamhockey.com pelhamhockey.com
pembrokeminorhockey.com pembrokeminorhockey.com
reignoftroy.com reignoftroy.com
petawawaminorhockey.ca petawawaminorhockey.ca
peterboroughunited-mad.co.uk peterboroughunited-mad.co.uk
phhsbigreds.com phhsbigreds.com
phsindians.info phsindians.info
pikecountyathletics.com pikecountyathletics.com
plymouthargyle-mad.co.uk plymouthargyle-mad.co.uk
popaxiom.com popaxiom.com
postandcourier.com postandcourier.com
poultonprimaryleague.co.uk poultonprimaryleague.co.uk
powerthesaurus.org powerthesaurus.org
prensalibre.com prensalibre.com
psdispatch.com psdispatch.com
psindians.com psindians.com
pswolves.com pswolves.com
pvnews.com pvnews.com
pwtorchlivecast.com pwtorchlivecast.com
qhubo.com qhubo.com
qocougars.com qocougars.com
queenspark-mad.co.uk queenspark-mad.co.uk
ramonahighathletics.com ramonahighathletics.com
ramsathletics.org ramsathletics.org
rap4ever.org rap4ever.org
rappler.com rappler.com
ravensathletics.com ravensathletics.com
razzball.com razzball.com
buzznoble.com buzznoble.com
rncavaliers.com rncavaliers.com
robotzrule.com robotzrule.com
rochdale-mad.co.uk rochdale-mad.co.uk
roscoeathletics.com roscoeathletics.com
royalathletics.net royalathletics.net
roughriderathletics.net roughriderathletics.net
roughridersports.net roughridersports.net
roverathletics.org roverathletics.org
rowancountyvikings.com rowancountyvikings.com
actitudfem.pro actitudfem.pro
cchsathletics.org cchsathletics.org
cchssports.com cchssports.com
rslkings.com rslkings.com
rugbydump.com rugbydump.com
rughookingmagazine.com rughookingmagazine.com
saeasports.org saeasports.org
safekidsworld.org safekidsworld.org
adjfl.co.uk adjfl.co.uk
saskballhockey.com saskballhockey.com
aecorteamer.club aecorteamer.club
sbisoccer.com sbisoccer.com
scpringette.com scpringette.com
scyl.org scyl.org
sdyfl.org sdyfl.org
alhslynx.com alhslynx.com
allaboutjazz.com allaboutjazz.com
sfbulldogathletics.com sfbulldogathletics.com
sgvikings.com sgvikings.com
allfreejewelrymaking.com allfreejewelrymaking.com
alvarezeagles.com alvarezeagles.com
shsgreyhounds.com shsgreyhounds.com
shsjaguars.com shsjaguars.com
shpanthernation.com shpanthernation.com
amherststeelecomets.com amherststeelecomets.com
amhsathletics.com amhsathletics.com
sidelionreport.com sidelionreport.com
amongtech.com amongtech.com
autzenzoo.com autzenzoo.com
animalog.online animalog.online
smcathletics.us smcathletics.us
animesonlinebr.biz animesonlinebr.biz
smtitansathletics.org smtitansathletics.org
smyrnahighathletics.com smyrnahighathletics.com
soaringdownsouth.com soaringdownsouth.com
antonymswords.com antonymswords.com
somoskudasai.com somoskudasai.com
songtextemania.com songtextemania.com
southernathletics.org southernathletics.org
southboundanddown.com southboundanddown.com
spacecoastdaily.com spacecoastdaily.com
apkjelly.com apkjelly.com
speckyboy.club speckyboy.club
spectator.org spectator.org
sportsplays.com sportsplays.com
sportingsota.com sportingsota.com
sswildcatactivities.com sswildcatactivities.com
stack.com stack.com
ashburnxtreme.org ashburnxtreme.org
012763.com 012763.com
013249.com 013249.com
statliners.com statliners.com
1035kissfmboise.com 1035kissfmboise.com
103kkcn.com 103kkcn.com
1073popcrush.com 1073popcrush.com
10best.com 10best.com
10fastfingers.com 10fastfingers.com
stereogum.com stereogum.com
12news.com 12news.com
1520theticket.com 1520theticket.com
15a20.com.mx 15a20.com.mx
stormthepaint.com stormthepaint.com
studio92.com studio92.com
aaskylineathletics.com aaskylineathletics.com
stxcharge.com stxcharge.com
achswolvesathletics.net achswolvesathletics.net
allfreepapercrafts.com allfreepapercrafts.com
swanseaseniorfootballleague.co.uk swanseaseniorfootballleague.co.uk
svilleathletics.com svilleathletics.com
swmavs.com swmavs.com
swrandolphathletics.com swrandolphathletics.com
ancafl.co.uk ancafl.co.uk
androidcentral.com androidcentral.com
apacheathletics.org apacheathletics.org
tabs4acoustic.com tabs4acoustic.com
talkchelsea.net talkchelsea.net
atalakers.com atalakers.com
taringa.net taringa.net
tcwestathletics.org tcwestathletics.org
atwateraviators.com atwateraviators.com
technobuffalo.com technobuffalo.com
televisa.com televisa.com
tenntruth.com tenntruth.com
austinopiaterehab.com austinopiaterehab.com
terrapinstationmd.com terrapinstationmd.com
avnetwork.com avnetwork.com
awesome923.com awesome923.com
awesome98.com awesome98.com
aydengriftonathletics.com aydengriftonathletics.com
ayersvillepilots.com ayersvillepilots.com
theboombox.com theboombox.com
ayrshireafa.co.uk ayrshireafa.co.uk
theleftoversnews.com theleftoversnews.com
themorningsun.com themorningsun.com
therattrick.com therattrick.com
therecorddelta.com therecorddelta.com
badgerofhonor.com badgerofhonor.com
thesphl.com thesphl.com
bairdbearathletics.com bairdbearathletics.com
thhsathletics.com thhsathletics.com
thisis50.com thisis50.com
thv11.com thv11.com
festusathletics.com festusathletics.com
throughthephog.com throughthephog.com
thunderousintentions.com thunderousintentions.com
tiebreaker.com tiebreaker.com
tinymixtapes.com tinymixtapes.com
tippecanoevalleyathletics.com tippecanoevalleyathletics.com
times-standard.com times-standard.com
timesheraldonline.com timesheraldonline.com
timesnowmarathi.com timesnowmarathi.com
timesunion.com timesunion.com
tisdaleminorhockey.com tisdaleminorhockey.com
titanathleticshq.com titanathleticshq.com
barnsleyanddistrictjfl.co.uk barnsleyanddistrictjfl.co.uk
barnsleyfa.co.uk barnsleyfa.co.uk
tmhswildcatsathletics.com tmhswildcatsathletics.com
tomshardware.co.uk tomshardware.co.uk
bayathletics.org bayathletics.org
toocool2betrue.com toocool2betrue.com
tooeleathletics.org tooeleathletics.org
bchstigers.com bchstigers.com
bdltbxf.com bdltbxf.com
bdyfl.co.uk bdyfl.co.uk
torl.ca torl.ca
tornadoathletics.org tornadoathletics.org
tosawesttrojans.com tosawesttrojans.com
bealestreetbears.com bealestreetbears.com
totalsacramentokings.com totalsacramentokings.com
totalufc.com totalufc.com
totalwba.com totalwba.com
bedfordrock.com bedfordrock.com
behsathletics.com behsathletics.com
beijixingyl.net beijixingyl.net
triwestbruins.com triwestbruins.com
trojansrugby.co.uk trojansrugby.co.uk
bereanathletics.org bereanathletics.org
bessemerathletics.com bessemerathletics.com
twinsdaily.com twinsdaily.com
tycsportsplay.com tycsportsplay.com
uasdathletics.com uasdathletics.com
bfbluejays.com bfbluejays.com
uchscenturions.com uchscenturions.com
uglyeaglesathletics.com uglyeaglesathletics.com
unfinishedman.com unfinishedman.com
upbeatnews.com upbeatnews.com
unofficialnetworks.com unofficialnetworks.com
bikez.com bikez.com
billiesathletics.com billiesathletics.com
binghamathletics.com binghamathletics.com
usatodayhss.com usatodayhss.com
birdathletics.com birdathletics.com
bishopcanevinathletics.com bishopcanevinathletics.com
bishopmoorecatholicathletics.com bishopmoorecatholicathletics.com
bishopnollathletics.org bishopnollathletics.org
varinaathletics.com varinaathletics.com
blackoutdallas.com blackoutdallas.com
vcscrusaderathletics.com vcscrusaderathletics.com
bleedinblue.com bleedinblue.com
blpanthers.com blpanthers.com
blscots.org blscots.org
vivaglammagazine.com vivaglammagazine.com
visordown.com visordown.com
vnnplayground.com vnnplayground.com
vocesabia.biz vocesabia.biz
boazathletics.com boazathletics.com
wakeupmrwest.com wakeupmrwest.com
waconiaathletics.com waconiaathletics.com
warman3on3.com warman3on3.com
waylandunionwildcats.com waylandunionwildcats.com
wearebartlett.com wearebartlett.com
wearemaranatha.com wearemaranatha.com
wcmha.ca wcmha.ca
webdesignerdepot.com webdesignerdepot.com
bpringette.ca bpringette.ca
brcardinals.com brcardinals.com
break.com.ar break.com.ar
weide28.com weide28.com
wendelltrojansports.com wendelltrojansports.com
wenonahdragonathletics.com wenonahdragonathletics.com
wesleychapelathletics.com wesleychapelathletics.com
westbloomfieldathletics.com westbloomfieldathletics.com
westcoastconvo.com westcoastconvo.com
westernpanthersports.com westernpanthersports.com
westfieldathletics.com westfieldathletics.com
wghawksactivities.com wghawksactivities.com
whatismyipaddress.com whatismyipaddress.com
brockleycc.co.uk brockleycc.co.uk
wheelerbearcatsathletics.com wheelerbearcatsathletics.com
whhssports.com whhssports.com
whsowls.com whsowls.com
wickfest.com wickfest.com
wideopeneats.com wideopeneats.com
whodatdish.com whodatdish.com
wildaaa.ca wildaaa.ca
bryanstationathletics.com bryanstationathletics.com
bsmotoring.com bsmotoring.com
bswildcats.com bswildcats.com
winchesterfootballleague.co.uk winchesterfootballleague.co.uk
btw-athletics.com btw-athletics.com
buckeyebucks.org buckeyebucks.org
buffzone.com buffzone.com
wnaw.com wnaw.com
woodbuffaloballhockeyleague.ca woodbuffaloballhockeyleague.ca
burlesonathletics.com burlesonathletics.com
worldlifestyle.com worldlifestyle.com
worldboxingnews.net worldboxingnews.net
wowhead.com wowhead.com
wpspanthers.com wpspanthers.com
wrenhurricanesathletics.com wrenhurricanesathletics.com
wrhsfalcons.com wrhsfalcons.com
wtug.com wtug.com
byroncentersports.com byroncentersports.com
cadetathletics.com cadetathletics.com
wxwildcats.com wxwildcats.com
wycombesaintsfc.org.uk wycombesaintsfc.org.uk
wyomingwolvesathletics.com wyomingwolvesathletics.com
cagepages.com cagepages.com
cahlhockey.net cahlhockey.net
camdenfutsalleague.co.uk camdenfutsalleague.co.uk
dlisted.com dlisted.com
ycmha.ca ycmha.ca
yorktownathletics.com yorktownathletics.com
caspercowboy.com caspercowboy.com
cbbtoday.com cbbtoday.com
celebdirtylaundry.com celebdirtylaundry.com
cfallsathletics.org cfallsathletics.org
cfhspanthers.com cfhspanthers.com
ziperto.com ziperto.com
cheapeatsthriftycrafts.com cheapeatsthriftycrafts.com
chhsathletics.com chhsathletics.com
rd.com rd.com
chsathletics.net chsathletics.net
chscolts.org chscolts.org
chsgreyhounds.com chsgreyhounds.com
hawkeyesathletics.com hawkeyesathletics.com
cirangers.org cirangers.org
clarencevilleathletics.com clarencevilleathletics.com
clemsonsportstalk.com clemsonsportstalk.com
clrvynt.com clrvynt.com
clyfa.co.uk clyfa.co.uk
coffmanathletics.net coffmanathletics.net
collegefootballpoll.com collegefootballpoll.com
cometsgalaxy.com cometsgalaxy.com
coogs4life.net coogs4life.net
cookandshare.com cookandshare.com
coppellathletics.com coppellathletics.com
coppercountrynews.com coppercountrynews.com
cosbytitansathletics.com cosbytitansathletics.com
covenantathletics.org covenantathletics.org
cowdenbeath-mad.co.uk cowdenbeath-mad.co.uk
cpgha.ca cpgha.ca
cqst.ca cqst.ca
crackberry.com crackberry.com
creativesports2.com creativesports2.com
cupertinoathletics.com cupertinoathletics.com
cvaviators.com cvaviators.com
cvilleathletics.com cvilleathletics.com
cvjags.com cvjags.com
cwmods.com cwmods.com
cyclonefanatic.com cyclonefanatic.com
dagelijksevideos.nl dagelijksevideos.nl
daily-stuff.com daily-stuff.com
dailyconservative.com dailyconservative.com
dailyentertainmentnews.com dailyentertainmentnews.com
dailytribune.com dailytribune.com
dawgpost.com dawgpost.com
dawnofthedawg.com dawnofthedawg.com
deperedeacons.com deperedeacons.com
deportivo365.com deportivo365.com
dha.com.tr dha.com.tr
dhscats.com dhscats.com
dhsvikingsports.com dhsvikingsports.com
divinity.es divinity.es
dixonramsathletics.com dixonramsathletics.com
dndtools.net dndtools.net
dovikingsathletics.com dovikingsathletics.com
downeyathletics.com downeyathletics.com
dpsmarshallathletics.com dpsmarshallathletics.com
dpsmeadowdaleathletics.com dpsmeadowdaleathletics.com
dpsponitzathletics.com dpsponitzathletics.com
dreadnaughtathletics.com dreadnaughtathletics.com
drivespark.com drivespark.com
drumhellerraptorshockey.com drumhellerraptorshockey.com
dunlapeaglesathletics.com dunlapeaglesathletics.com
duqssportsproperties.com duqssportsproperties.com
dwightmorrowraiders.com dwightmorrowraiders.com
eastathletics.org eastathletics.org
eastbournerugby.com eastbournerugby.com
eastlancsleague.com eastlancsleague.com
eastthunderhawks.com eastthunderhawks.com
eauclaireathletics.org eauclaireathletics.org
ecaathletics.org ecaathletics.org
edgewoodmustangsathletics.com edgewoodmustangsathletics.com
editorinleaf.com editorinleaf.com
efthunderbirds.com efthunderbirds.com
ehcsathletics.com ehcsathletics.com
ehs-tigers.com ehs-tigers.com
elfarandi.com elfarandi.com
elgrafico.com elgrafico.com
elmsathletics.org elmsathletics.org
elmundo.es elmundo.es
elmwoodparkathletics.com elmwoodparkathletics.com
elsegundoathletics.com elsegundoathletics.com
eltiempolv.com eltiempolv.com
eltrecetv.com.ar eltrecetv.com.ar
eluniversal.com.mx eluniversal.com.mx
eprmha.ca eprmha.ca
esoui.com esoui.com
ettingersmithmemorial.org ettingersmithmemorial.org
evansathletics.com evansathletics.com
evansvillenorthathletics.com evansvillenorthathletics.com
everythingontap.com everythingontap.com
eyesonisles.com eyesonisles.com
fabwags.com fabwags.com
fairfieldathletics.org fairfieldathletics.org
fbschedules.com fbschedules.com
fclionathletics.com fclionathletics.com
femalefirst.co.uk femalefirst.co.uk
hawtcelebs.com hawtcelebs.com
fhcrangers.com fhcrangers.com
fhs-warriors.com fhs-warriors.com
fightbookmma.com fightbookmma.com
filmibeat.com filmibeat.com
firefaucet.win firefaucet.win
fisherstigersathletics.com fisherstigersathletics.com
fonddulacbears.com fonddulacbears.com
fourfourtwo.com fourfourtwo.com
friendlyathletics.org friendlyathletics.org
frontieracademyathletics.com frontieracademyathletics.com
frontierathletics.com frontierathletics.com
fsusathletics.com fsusathletics.com
fwoe.club fwoe.club
gaithersburgathletics.com gaithersburgathletics.com
gateshead-mad.co.uk gateshead-mad.co.uk
gcak12athletics.org gcak12athletics.org
gcaspartansports.com gcaspartansports.com
gchscougars.com gchscougars.com
gcmpatriots.com gcmpatriots.com
geeksided.com geeksided.com
geektyrant.com geektyrant.com
ghnorthernoaksathletics.org ghnorthernoaksathletics.org
glendaleprepathletics.com glendaleprepathletics.com
glennathletics.com glennathletics.com
glenoakathletics.org glenoakathletics.org
gmenhq.com gmenhq.com
goaviatorsathletics.com goaviatorsathletics.com
gobearcats.org gobearcats.org
gobgnsports.com gobgnsports.com
gobigredathletics.com gobigredathletics.com
gobluecats.com gobluecats.com
gocabeacons.com gocabeacons.com
gocaliforniaathletics.com gocaliforniaathletics.com
gocanebayathletics.net gocanebayathletics.net
gocentralindians.com gocentralindians.com
goclarkathletics.com goclarkathletics.com
gohermleigh.com gohermleigh.com
goherronathletics.com goherronathletics.com
gohornetsathletics.com gohornetsathletics.com
gokanelandknights.com gokanelandknights.com
goknightsathletics.com goknightsathletics.com
golakeviewsports.com golakeviewsports.com
golamarmustangs.com golamarmustangs.com
gomhswarhawks.com gomhswarhawks.com
gomightyarabs.com gomightyarabs.com
gomustangathletics.com gomustangathletics.com
goody25.com goody25.com
gopantherathletics.com gopantherathletics.com
gopaolirams.com gopaolirams.com
gophoenixathletics.com gophoenixathletics.com
goportageindians.com goportageindians.com
gorangernation.com gorangernation.com
gordonleeathletics.com gordonleeathletics.com
goredknightathletics.org goredknightathletics.org
goroyalsgo.net goroyalsgo.net
gosachristian.org gosachristian.org
gotjpatsathletics.com gotjpatsathletics.com
govalhalla.org govalhalla.org
govikingathletics.com govikingathletics.com
goyellowjacketsathletics.com goyellowjacketsathletics.com
gpucheck.com gpucheck.com
gridironnow.net gridironnow.net
gromforum.com gromforum.com
gstitans.com gstitans.com
guiaturista.es guiaturista.es
gvgatorathletics.com gvgatorathletics.com
halifaxhockey.ca halifaxhockey.ca
hancockcountyathletics.com hancockcountyathletics.com
haraiders.com haraiders.com
hardwoodhoudini.com hardwoodhoudini.com
hboilersports.com hboilersports.com
hcbeavers.org hcbeavers.org
hchshornets.com hchshornets.com
hddmag.com hddmag.com
hdyfl.co.uk hdyfl.co.uk
headcoachranking.com headcoachranking.com
heatwaved.com heatwaved.com
helloaba.com helloaba.com
helloalliance.com helloalliance.com
helloalpharetta.com helloalpharetta.com
helloalvin.com helloalvin.com
helloamerica.com helloamerica.com
helloamsterdam.com helloamsterdam.com
helloanacortes.com helloanacortes.com
helloanderson.com helloanderson.com
helloarvada.com helloarvada.com
helloashtabula.com helloashtabula.com
hellobarbados.com hellobarbados.com
hellobastrop.com hellobastrop.com
hellobellflower.com hellobellflower.com
hellobellwood.com hellobellwood.com
hellobelvidere.com hellobelvidere.com
hellobillings.com hellobillings.com
helloblaine.com helloblaine.com
hellobluesprings.com hellobluesprings.com
hellobonn.com hellobonn.com
hellobrookfield.com hellobrookfield.com
hellocayce.com hellocayce.com
hellochanhassen.com hellochanhassen.com
hellochengdu.com hellochengdu.com
hellocooper.com hellocooper.com
hellodenton.com hellodenton.com
hellodothan.com hellodothan.com
helloelkhart.com helloelkhart.com
helloflowermound.com helloflowermound.com
hellofontana.com hellofontana.com
hellograpevine.com hellograpevine.com
hellogreeley.com hellogreeley.com
helloharrisonburg.com helloharrisonburg.com
hellohazelpark.com hellohazelpark.com
hellohighpoint.com hellohighpoint.com
hellohilliard.com hellohilliard.com
helloindependence.com helloindependence.com
hellokampala.com hellokampala.com
hellokefalonia.com hellokefalonia.com
hellokennewick.com hellokennewick.com
hellolewiston.com hellolewiston.com
helloliberty.com helloliberty.com
hellolorain.com hellolorain.com
hellolynbrook.com hellolynbrook.com
hellomanchester.com hellomanchester.com
hellomatthews.com hellomatthews.com
hellomelrose.com hellomelrose.com
hellometro.com hellometro.com
hellomountwashington.com hellomountwashington.com
hellonorthroyalton.com hellonorthroyalton.com
helloomdurman.com helloomdurman.com
hellooperator.com hellooperator.com
hellooregon.com hellooregon.com
hellophenix.com hellophenix.com
hellopicorivera.com hellopicorivera.com
hellopigeonforge.com hellopigeonforge.com
helloplattsburgh.com helloplattsburgh.com
helloporterville.com helloporterville.com
helloportlandme.com helloportlandme.com
helloportlandor.com helloportlandor.com
hellopriorlake.com hellopriorlake.com
helloranchocordova.com helloranchocordova.com
hellorhodes.com hellorhodes.com
hellorichardson.com hellorichardson.com
hellosaintmatin.com hellosaintmatin.com
hellosandsprings.com hellosandsprings.com
hellosandysprings.com hellosandysprings.com
hellosapulpa.com hellosapulpa.com
hellosavage.com hellosavage.com
helloshakopee.com helloshakopee.com
helloshermanoaks.com helloshermanoaks.com
hellosierravista.com hellosierravista.com
hellosimivalley.com hellosimivalley.com
helloskokievillage.com helloskokievillage.com
hellosouthelgin.com hellosouthelgin.com
hellosouthelmonte.com hellosouthelmonte.com
hellosoweto.com hellosoweto.com
hellosterlingheights.com hellosterlingheights.com
hellosurat.com hellosurat.com
hellotempleterrace.com hellotempleterrace.com
helloterrehaute.com helloterrehaute.com
hellotiffin.com hellotiffin.com
hellotorrance.com hellotorrance.com
hellotupelo.com hellotupelo.com
hellowales.com hellowales.com
hellowaukesha.com hellowaukesha.com
hellowaxahachie.com hellowaxahachie.com
hellowebstergroves.com hellowebstergroves.com
hellowilson.com hellowilson.com
hellowinterhaven.com hellowinterhaven.com
hellowisconsinrapids.com hellowisconsinrapids.com
helloxian.com helloxian.com
helloyakima.com helloyakima.com
helloypsilanti.com helloypsilanti.com
hellozachary.com hellozachary.com
henryclayathletics.com henryclayathletics.com
heritagenews.com heritagenews.com
hesperiaathletics.com hesperiaathletics.com
hgfpl.co.uk hgfpl.co.uk
hhihsathletics.org hhihsathletics.org
hightownjfl.co.uk hightownjfl.co.uk
hillcrestathletics.org hillcrestathletics.org
hillcrestknightsathletics.com hillcrestknightsathletics.com
hinkleyathletics.com hinkleyathletics.com
hollywoodhiccups.com hollywoodhiccups.com
hookemheadlines.com hookemheadlines.com
hoopshabit.com hoopshabit.com
hooverhighathletics.com hooverhighathletics.com
hopevalleyleague.co.uk hopevalleyleague.co.uk
hrvathletics.com hrvathletics.com
htvnativeadsolutions.com htvnativeadsolutions.com
hudsonvilleathletics.com hudsonvilleathletics.com
huffmanhighschoolathletics.com huffmanhighschoolathletics.com
hulkpop.com hulkpop.com
hurricanesathletics.com hurricanesathletics.com
hvgbminorsoccer.ca hvgbminorsoccer.ca
iccpathletics.org iccpathletics.org
idcfl.co.uk idcfl.co.uk
iknowthescore.co.uk iknowthescore.co.uk
indiehoy.com indiehoy.com
iphonehacks.com iphonehacks.com
irabulldogs.org irabulldogs.org
irishsportsdaily.com irishsportsdaily.com
jdvolsathletics.com jdvolsathletics.com
jeevansathi.com jeevansathi.com
jetswhiteout.com jetswhiteout.com
jgathletics.org jgathletics.org
jichsathletics.com jichsathletics.com
jpecfalcons.com jpecfalcons.com
jwnorthathletics.org jwnorthathletics.org
kalkaskaathletics.com kalkaskaathletics.com
kashmereathletics.com kashmereathletics.com
kearsleyhornets.org kearsleyhornets.org
khou.com khou.com
koolfmabilene.com koolfmabilene.com
kpel965.com kpel965.com
ksdk.com ksdk.com
ksenam.com ksenam.com
ksisradio.com ksisradio.com
kwknights.com kwknights.com
lacrossepei.ca lacrossepei.ca
lahstoppers.com lahstoppers.com
lakenonaathletics.org lakenonaathletics.org
lamarcountyathletics.com lamarcountyathletics.com
lamarledger.com lamarledger.com
laplataathletics.org laplataathletics.org
laramielive.com laramielive.com
lastwordonrugby.com lastwordonrugby.com
lavandos.pro lavandos.pro
lazers.ca lazers.ca
lccathletics.com lccathletics.com
lcghl.com lcghl.com
lebanonathletics.com lebanonathletics.com
lebanonathletics.org lebanonathletics.org
leopardathletics.org leopardathletics.org
lhhighlanderathletics.com lhhighlanderathletics.com
lhs-trojans.com lhs-trojans.com
lickingvalleyathletics.com lickingvalleyathletics.com
liquiddota.com liquiddota.com
lisburnjuniorfootballleague.co.uk lisburnjuniorfootballleague.co.uk
listegaleri.com listegaleri.com
ljhuskyathletics.com ljhuskyathletics.com
lmtonline.com lmtonline.com
lobandsmash.com lobandsmash.com
londonjuniormustangs.com londonjuniormustangs.com
lorainathletics.org lorainathletics.org
lorettoacademyathletics.com lorettoacademyathletics.com
lovepanky.com lovepanky.com
lphsathletics.net lphsathletics.net
lshsactivities.com lshsactivities.com
ludlowathletics.org ludlowathletics.org
lutontown-mad.co.uk lutontown-mad.co.uk
lyrical-nonsense.com lyrical-nonsense.com
lyricscraze.com lyricscraze.com
macdonaldhockey.ca macdonaldhockey.ca
manoramaonline.com manoramaonline.com
marauderathletics.com marauderathletics.com
marauderathletics.org marauderathletics.org
matadorsportsproperties.com matadorsportsproperties.com
mchsathletics.com mchsathletics.com
mckayathletics.com mckayathletics.com
mcmichaelathletics.com mcmichaelathletics.com
mcseagles.org mcseagles.org
medicaldaily.com medicaldaily.com
melfortminorhockey.ca melfortminorhockey.ca
memphisathletics.com memphisathletics.com
menaulsports.com menaulsports.com
mesquiteathletics.com mesquiteathletics.com
metasrc.com metasrc.com
mhspioneers.com mhspioneers.com
miamisburgathletics.com miamisburgathletics.com
micromaxinfo.com micromaxinfo.com
mid-carolinaathletics.com mid-carolinaathletics.com
middletownpress.com middletownpress.com
milacawolves.com milacawolves.com
milanathletics.com milanathletics.com
milenio.com milenio.com
milfordmavs.com milfordmavs.com
mixtapemonkey.com mixtapemonkey.com
mlspartanathletics.org mlspartanathletics.org
mmll.ca mmll.ca
mmmarauders.com mmmarauders.com
mmoui.com mmoui.com
monashoressports.com monashoressports.com
monctonminorhockey.ca monctonminorhockey.ca
mpanthers.com mpanthers.com
mrhssentinels.org mrhssentinels.org
msbbulldogs.com msbbulldogs.com
mtcssports.com mtcssports.com
mulberryathletics.com mulberryathletics.com
murrayhsathletics.com murrayhsathletics.com
musketfire.com musketfire.com
muzikum.eu muzikum.eu
mvcmustangs.com mvcmustangs.com
mwwire.com mwwire.com
mypembrokenc.com mypembrokenc.com
myplainview.com myplainview.com
mzbulldogs.com mzbulldogs.com
nesn.com nesn.com
neuquahockey.org neuquahockey.org
nevadapreps.com nevadapreps.com
newsd.co newsd.co
nflgamesim.com nflgamesim.com
nfraidersathletics.com nfraidersathletics.com
nhs-cougars.com nhs-cougars.com
nhsgladiatorsathletics.com nhsgladiatorsathletics.com
nilesathletics.com nilesathletics.com
njblackhawks.com njblackhawks.com
nmk.world nmk.world
nnusc.com nnusc.com
nolanwritin.com nolanwritin.com
northwesterntrojans.org northwesterntrojans.org
npftv.com npftv.com
nsfoa.ca nsfoa.ca
ntbhl.ca ntbhl.ca
nwmounties.com nwmounties.com
oakridgeathletics.org oakridgeathletics.org
objectivist.co objectivist.co
observer.com observer.com
ochsathletics.com ochsathletics.com
oclancerathletics.com oclancerathletics.com
oghspatriots.com oghspatriots.com
ohsathletics.org ohsathletics.org
ohscardinals.com ohscardinals.com
oldnorthbanter.com oldnorthbanter.com
olentangybravesathletics.com olentangybravesathletics.com
olentangyorangeathletics.com olentangyorangeathletics.com
olmstedfallsathletics.net olmstedfallsathletics.net
omahabryanbears.com omahabryanbears.com
onebarb.com onebarb.com
ontarioathletics.org ontarioathletics.org
opelikaathletics.com opelikaathletics.com
opslens.com opslens.com
oxigeno.com.pe oxigeno.com.pe
pacificwaverider.com pacificwaverider.com
paintbranchathletics.org paintbranchathletics.org
panorama.com.ve panorama.com.ve
paolahighschoolathletics.com paolahighschoolathletics.com
patsfans.com patsfans.com
pawofthetiger.com pawofthetiger.com
rhylanddistrictsundayleague.co.uk rhylanddistrictsundayleague.co.uk
rhsfalcons.com rhsfalcons.com
pcactivities.com pcactivities.com
pcpatriotsports.com pcpatriotsports.com
pdhsaztecs.com pdhsaztecs.com
pdslstoke.co.uk pdslstoke.co.uk
pelhamhighathletics.com pelhamhighathletics.com
pendletonathletics.com pendletonathletics.com
riftui.com riftui.com
rimathleticsactivities.com rimathleticsactivities.com
ringettepei.ca ringettepei.ca
perfil.com perfil.com
phsterrors.org phsterrors.org
pjfrfc.co.uk pjfrfc.co.uk
plhsfightingpointers.com plhsfightingpointers.com
plnkr.co plnkr.co
plymouthchristianeagles.com plymouthchristianeagles.com
pomonareddevilathletics.com pomonareddevilathletics.com
pottervilleathletics.com pottervilleathletics.com
powerpyx.com powerpyx.com
practicalcaravan.com practicalcaravan.com
practicalmachinist.com practicalmachinist.com
prbucksports.com prbucksports.com
riverforestathletics.com riverforestathletics.com
riverhawkathletics.com riverhawkathletics.com
rittmanathletics.org rittmanathletics.org
pricepanda.com.ph pricepanda.com.ph
progolfnow.com progolfnow.com
ptpanthers.org ptpanthers.org
ptwarriors.org ptwarriors.org
rabbitathletics.com rabbitathletics.com
radcliffefc.com radcliffefc.com
raftaar.in raftaar.in
ramonaathletics.com ramonaathletics.com
rap-up.com rap-up.com
raptorsrapture.com raptorsrapture.com
redarrowathletics.com redarrowathletics.com
redlandsdailyfacts.com redlandsdailyfacts.com
rnhl.ca rnhl.ca
roeperathletics.org roeperathletics.org
rogerbaconspartans.org rogerbaconspartans.org
ronproject.com ronproject.com
roxpile.com roxpile.com
rubidouxathletics.com rubidouxathletics.com
sabreathletics.org sabreathletics.org
aahuronathletics.com aahuronathletics.com
samacharjagat.com samacharjagat.com
saratogian.com saratogian.com
saskatoonballhockey.com saskatoonballhockey.com
saturdaydownsouth.com saturdaydownsouth.com
savagehumans.com savagehumans.com
addisonathletics.com addisonathletics.com
sciencealert2014.com sciencealert2014.com
screencrush.com screencrush.com
searchtempest.com searchtempest.com
ajhsprospectors.org ajhsprospectors.org
akinseaglessports.com akinseaglessports.com
sfhsdonsathletics.com sfhsdonsathletics.com
alternativemissoula.com alternativemissoula.com
allacronyms.com allacronyms.com
allaroundphilly.com allaroundphilly.com
sherwoodathletics.org sherwoodathletics.org
shopforyourcause.com shopforyourcause.com
albionrovers-mad.co.uk albionrovers-mad.co.uk
sicemdawgs.com sicemdawgs.com
sickchirpse.com sickchirpse.com
allmusicals.com allmusicals.com
sjajaguars.org sjajaguars.org
amandaclearcreekathletics.com amandaclearcreekathletics.com
sjhsathletics.com sjhsathletics.com
skidmore-tynanathletics.com skidmore-tynanathletics.com
slantmagazine.com slantmagazine.com
smhsathletics.com smhsathletics.com
smtigers.com smtigers.com
animanga.es animanga.es
snowflakelobosathletics.com snowflakelobosathletics.com
sohh.com sohh.com
sodomojo.com sodomojo.com
southsideshowdown.com southsideshowdown.com
andhrajyothy.com andhrajyothy.com
southchristiansports.com southchristiansports.com
southdearbornathletics.com southdearbornathletics.com
spellcheck.net spellcheck.net
spjfl.co.uk spjfl.co.uk
sportscastr.com sportscastr.com
sportschatplace.com sportschatplace.com
sprayberryathletics.com sprayberryathletics.com
springbrookathletics.org springbrookathletics.org
springfieldlocalathletics.com springfieldlocalathletics.com
srfalcons.org srfalcons.org
stairwayto11.com stairwayto11.com
009854.com 009854.com
014105.com 014105.com
014191.com 014191.com
014837.com 014837.com
1037thepeak.com 1037thepeak.com
1049theedge.com 1049theedge.com
1075zoofm.com 1075zoofm.com
107jamz.com 107jamz.com
stmaknights.com stmaknights.com
stranraer-mad.co.uk stranraer-mad.co.uk
1360binghamton.com 1360binghamton.com
1390granitecitysports.com 1390granitecitysports.com
13wmaz.com 13wmaz.com
1460espnyakima.com 1460espnyakima.com
ststephensathletics.org ststephensathletics.org
stthomasringette.ca stthomasringette.ca
summervilleathletics.com summervilleathletics.com
sunderland-mad.co.uk sunderland-mad.co.uk
supertalk1270.com supertalk1270.com
aegean-travel.com aegean-travel.com
afcwimbledon-mad.co.uk afcwimbledon-mad.co.uk
ahscolts.net ahscolts.net
ajfl.org.uk ajfl.org.uk
alagnathletics.com alagnathletics.com
swanseatigersathletics.com swanseatigersathletics.com
swbulldogs.com swbulldogs.com
aldershottown-mad.co.uk aldershottown-mad.co.uk
allfortennessee.com allfortennessee.com
animesonlinebr.site animesonlinebr.site
sztosowe.pl sztosowe.pl
annapolisathletics.com annapolisathletics.com
ansonrecord.com ansonrecord.com
apertura.com apertura.com
tabs-database.com tabs-database.com
arcadesushi.com arcadesushi.com
tascosarebels.org tascosarebels.org
tbirdathletics.com tbirdathletics.com
tcnathletics.com tcnathletics.com
teamerstg.net teamerstg.net
arlingtonlionsathletics.com arlingtonlionsathletics.com
techtimes.com techtimes.com
teleantillas.com.do teleantillas.com.do
tempostorm.com tempostorm.com
tenacityfastpitch.com tenacityfastpitch.com
australiangeographic.com.au australiangeographic.com.au
avforums.com avforums.com
avhshawkathletics.com avhshawkathletics.com
thechive.com thechive.com
thecouponingcouple.com thecouponingcouple.com
thefw.com thefw.com
thegolfnewsnet.com thegolfnewsnet.com
thepewterplank.com thepewterplank.com
thereporter.com thereporter.com
thesixersense.com thesixersense.com
thesurfersview.com thesurfersview.com
thscougarsathletics.com thscougarsathletics.com
tigernet.com tigernet.com
bamahammer.com bamahammer.com
timberlandathletics.com timberlandathletics.com
timvandevall.com timvandevall.com
tkathletics.com tkathletics.com
titannationathletics.com titannationathletics.com
titansized.com titansized.com
tmba.ca tmba.ca
baseballpress.com baseballpress.com
batesvilleathletics.com batesvilleathletics.com
top-law-schools.com top-law-schools.com
tosaeastathletics.com tosaeastathletics.com
total76ers.com total76ers.com
totalacc.com totalacc.com
totalastros.com totalastros.com
totalbig10.com totalbig10.com
totalbluejackets.com totalbluejackets.com
totalbuffalobills.com totalbuffalobills.com
totalcanucks.com totalcanucks.com
totaldiamondbacks.com totaldiamondbacks.com
totalgeorgiasouthern.com totalgeorgiasouthern.com
totallosangeleskings.com totallosangeleskings.com
totalnwa.com totalnwa.com
totalrays.com totalrays.com
totalsportswire.com totalsportswire.com
totaluconn.com totaluconn.com
totalwhitesox.com totalwhitesox.com
bcbay.com bcbay.com
bcpfa.ca bcpfa.ca
tpathletics.org tpathletics.org
bdpsports.com bdpsports.com
beartrapsummerfestival.com beartrapsummerfestival.com
bedequeminorhockey.com bedequeminorhockey.com
behindthebuckpass.com behindthebuckpass.com
trumanstales.com trumanstales.com
berksmontnews.com berksmontnews.com
tvilleathletics.com tvilleathletics.com
twinpeakscharteracademyathletics.com twinpeakscharteracademyathletics.com
uber-facts.com uber-facts.com
ucclfootball.co.uk ucclfootball.co.uk
uchsathletics.com uchsathletics.com
bethcenterbulldogs.com bethcenterbulldogs.com
uhnd.com uhnd.com
uhsathletics.org uhsathletics.org
uhsutes.com uhsutes.com
ukulele-tabs.com ukulele-tabs.com
ultimateclassicrock.com ultimateclassicrock.com
bhopalsamachar.com bhopalsamachar.com
bhpbears.com bhpbears.com
bhsathletics.org bhsathletics.org
bhsbulldogs.com bhsbulldogs.com
upperstclairathletics.com upperstclairathletics.com
urbo.com urbo.com
usatoday.com usatoday.com
uwatchfreetv.online uwatchfreetv.online
vahsathletics.com vahsathletics.com
birminghamcity-mad.co.uk birminghamcity-mad.co.uk
vchsathletics.com vchsathletics.com
venomstrikes.com venomstrikes.com
blackandteal.com blackandteal.com
blackhawkup.com blackhawkup.com
blakeathletics.org blakeathletics.org
bldaily.com bldaily.com
vnnsportshub.net vnnsportshub.net
vmhsathletics.com vmhsathletics.com
bluemanhoop.com bluemanhoop.com
voiceofamarillo.com voiceofamarillo.com
bobcatathletics.org bobcatathletics.org
wainwrightminorball.ca wainwrightminorball.ca
walesveteransfootball.co.uk walesveteransfootball.co.uk
bogalusalumberjacks.org bogalusalumberjacks.org
wallaseyanddistrictsfl.co.uk wallaseyanddistrictsfl.co.uk
bogiceskating.com bogiceskating.com
bolde.com bolde.com
boltsbythebay.com boltsbythebay.com
wareshoalsathletics.com wareshoalsathletics.com
watch.bz watch.bz
wcbears.com wcbears.com
wdathletics.com wdathletics.com
waukeshawarhawks.org waukeshawarhawks.org
waverlywarriorsathletics.com waverlywarriorsathletics.com
wawaseeathletics.com wawaseeathletics.com
wbckfm.com wbckfm.com
wdwmagic.com wdwmagic.com
wearecamdenhs.com wearecamdenhs.com
weaselzippers.us weaselzippers.us
bostonherald.com bostonherald.com
bouldercityreview.com bouldercityreview.com
bowiebulldogathletics.com bowiebulldogathletics.com
weboathletics.com weboathletics.com
weddbook.com weddbook.com
bradleyathletics.org bradleyathletics.org
break410.com break410.com
westalbanybulldogs.com westalbanybulldogs.com
breatheheavy.com breatheheavy.com
wfhscoyoteathletics.com wfhscoyoteathletics.com
brhsjacketpride.com brhsjacketpride.com
wheatonknights.com wheatonknights.com
wheelerwildcatathletics.com wheelerwildcatathletics.com
briha.org briha.org
whynews.com whynews.com
wibx950.com wibx950.com
wicklowleague.com wicklowleague.com
wideopenpets.com wideopenpets.com
wideopenroads.com wideopenroads.com
willitsnews.com willitsnews.com
broomfieldenterprise.com broomfieldenterprise.com
wiree.live wiree.live
bsebportal.com bsebportal.com
bsfl.co.uk bsfl.co.uk
witl.com witl.com
bssjaguars.com bssjaguars.com
wjathletics.org wjathletics.org
wmtornadoes.com wmtornadoes.com
buckeyevalleyathletics.com buckeyevalleyathletics.com
buffalo.com buffalo.com
bulldogsathletics.com bulldogsathletics.com
worldsoccertalk.com worldsoccertalk.com
wpdh.com wpdh.com
wrkr.com wrkr.com
wwltv.com wwltv.com
wxcowboys.com wxcowboys.com
byacoedsoftballtournament.com byacoedsoftballtournament.com
caaleague.org caaleague.org
caneswarning.com caneswarning.com
canoncitydailyrecord.com canoncitydailyrecord.com
capacathletics.com capacathletics.com
capecatfish.com capecatfish.com
henrycountyathletics.com henrycountyathletics.com
yorktonunitedfc.ca yorktonunitedfc.ca
youredm.com youredm.com
ypff.co.uk ypff.co.uk
ypsigrizzlies.com ypsigrizzlies.com
cavaliersnation.com cavaliersnation.com
cavernaathletics.com cavernaathletics.com
cbcmha.ca cbcmha.ca
cbwmh.ca cbwmh.ca
ncraiders.com ncraiders.com
cedarspringsathletics.com cedarspringsathletics.com
cfbstats.com cfbstats.com
checkingcreditcard.com checkingcreditcard.com
chemics.net chemics.net
chhshoops.com chhshoops.com
chicoer.com chicoer.com
tl.net tl.net
chscougarathletics.com chscougarathletics.com
churchillathletics.com churchillathletics.com
cifras.com.br cifras.com.br
cincomas.com cincomas.com
clackamasathletics.com clackamasathletics.com
claireandjamie.com claireandjamie.com
cmhornets.net cmhornets.net
cnhockey.com cnhockey.com
coacht.com coacht.com
coingape.com coingape.com
company.directory company.directory
comstockparkathletics.com comstockparkathletics.com
concordhsathletics.com concordhsathletics.com
coolmaterial.com coolmaterial.com
copleyathletics.org copleyathletics.org
coqmoodyringette.com coqmoodyringette.com
cougarnation.us cougarnation.us
covathletics.org covathletics.org
coveralia.com coveralia.com
cowanathletics.com cowanathletics.com
cpgophers.com cpgophers.com
csgo-stats.com csgo-stats.com
cssfl.org.uk cssfl.org.uk
cuatro.com cuatro.com
cubaheadlines.com cubaheadlines.com
cucinare.tv cucinare.tv
curioushistorian.com curioushistorian.com
cuyhtsathletics.com cuyhtsathletics.com
cvhsgrizzlies.net cvhsgrizzlies.net
cypresscreekathletics.com cypresscreekathletics.com
cypruspiratesathletics.com cypruspiratesathletics.com
dailybulletin.com dailybulletin.com
dcschoolathletics.org dcschoolathletics.org
dealmaxx.net dealmaxx.net
deautos.com deautos.com
derbycounty-mad.co.uk derbycounty-mad.co.uk
dfwrestaurantweek.com dfwrestaurantweek.com
nctsharknation.com nctsharknation.com
diario.mx diario.mx
diaspora7.com diaspora7.com
dicksonathletics.com dicksonathletics.com
dockathletics.org dockathletics.org
doctorwhowatch.com doctorwhowatch.com
dorksideoftheforce.com dorksideoftheforce.com
dovermercurysfl.co.uk dovermercurysfl.co.uk
downersgrovesouthathletics.com downersgrovesouthathletics.com
dpsstiversathletics.com dpsstiversathletics.com
drhsjaguars.com drhsjaguars.com
driffielddistrictafl.co.uk driffielddistrictafl.co.uk
dublinathletics.org dublinathletics.org
dublinathletics.us dublinathletics.us
dukereport.com dukereport.com
dunkingwithwolves.com dunkingwithwolves.com
dutchtownathletics.com dutchtownathletics.com
ecathletics.org ecathletics.org
eckvilleminorhockey.com eckvilleminorhockey.com
economiahoy.mx economiahoy.mx
ectrojansathletics.com ectrojansathletics.com
edetroit.co edetroit.co
edgewaterathletics.com edgewaterathletics.com
edgewoodcougarathletics.com edgewoodcougarathletics.com
eelsathletics.com eelsathletics.com
efstaging.com efstaging.com
egthunderbirds.com egthunderbirds.com
einsteinathletics.org einsteinathletics.org
ekfalcons.com ekfalcons.com
elcaminoathletics.org elcaminoathletics.org
elcolombiano.com elcolombiano.com
elcomercio.com elcomercio.com
elranchodons.com elranchodons.com
elrincondelmiedo.com elrincondelmiedo.com
eluniverso.com eluniverso.com
elwoodpanthers.net elwoodpanthers.net
epochtimes.de epochtimes.de
eshsathletics.com eshsathletics.com
esologs.com esologs.com
espn1420.com espn1420.com
espn935.com espn935.com
espn991.com espn991.com
estevanminorhockey.com estevanminorhockey.com
evanstonathletics.com evanstonathletics.com
examinedexistence.com examinedexistence.com
fadeawayworld.net fadeawayworld.net
fansided.com fansided.com
fcgriffins.com fcgriffins.com
feedclub.com.br feedclub.com.br
fentonathletics.org fentonathletics.org
fextralife.com fextralife.com
fightingeaglesports.org fightingeaglesports.org
fightinggobbler.com fightinggobbler.com
fikeathletics.com fikeathletics.com
filerathletics.com filerathletics.com
flywareagle.com flywareagle.com
fnsflagfootball.ca fnsflagfootball.ca
folsomathletics.com folsomathletics.com
foodsided.com foodsided.com
footballoutsiders.com footballoutsiders.com
footballscoop.com footballscoop.com
fourfourcrew.com fourfourcrew.com
frankenmuthathletics.com frankenmuthathletics.com
funbrk.com funbrk.com
funsubstance.com funsubstance.com
futboltotal.com.mx futboltotal.com.mx
fvhsathletics.com fvhsathletics.com
gadsdencityathletics.com gadsdencityathletics.com
gaffneyindiansathletics.com gaffneyindiansathletics.com
gagadaily.com gagadaily.com
gamespew.com gamespew.com
gametimect.com gametimect.com
garawayathletics.com garawayathletics.com
gatesheadanddistrictsundayleague.co.uk gatesheadanddistrictsundayleague.co.uk
gazettes.com gazettes.com
gcshawks.com gcshawks.com
gestiopolis.com gestiopolis.com
gizbot.com gizbot.com
gjhstigers.com gjhstigers.com
glacierpilots.com glacierpilots.com
gnashockey.com gnashockey.com
goadamscentralathletics.com goadamscentralathletics.com
goaledobearcats.com goaledobearcats.com
gobeavertonbeavers.com gobeavertonbeavers.com
gobigredknox.com gobigredknox.com
goblackshirts.com goblackshirts.com
gocardinalritter.org gocardinalritter.org
gocelts.com gocelts.com
gocentralsports.com gocentralsports.com
goclementsfootball.com goclementsfootball.com
goclspartans.org goclspartans.org
godinezathletics.com godinezathletics.com
goeasterneagles.org goeasterneagles.org
gofalconathletics.com gofalconathletics.com
gofalconsports.org gofalconsports.org
goganders.com goganders.com
gohammondathletics.com gohammondathletics.com
goheritage.org goheritage.org
gohhshurricanes.com gohhshurricanes.com
gohowebulldogs.net gohowebulldogs.net
gokennedycavs.com gokennedycavs.com
gomaroonsathletics.com gomaroonsathletics.com
gonorthridgevikings.com gonorthridgevikings.com
goplymouthathletics.com goplymouthathletics.com
gorajahs.com gorajahs.com
gorebelsathletics.com gorebelsathletics.com
goriversideathletics.com goriversideathletics.com
gosabercatsgo.com gosabercatsgo.com
goscarboroughspartans.com goscarboroughspartans.com
govikingsathletics.com govikingsathletics.com
gowbmillers.com gowbmillers.com
gowildcatactivities.com gowildcatactivities.com
greatheartsirvingathletics.org greatheartsirvingathletics.org
groceryshopforfree.com groceryshopforfree.com
grubstreet.com grubstreet.com
guiadelnino.com guiadelnino.com
guiadelocio.com guiadelocio.com
guiamicasamiento.com guiamicasamiento.com
guiaturista.com.mx guiaturista.com.mx
gwcarversports.com gwcarversports.com
hadd.world hadd.world
haftrhawks.com haftrhawks.com
hailvarsity.com hailvarsity.com
hancinema.net hancinema.net
hcaeaglessports.org hcaeaglessports.org
hcbeavers.net hcbeavers.net
helloallen.com helloallen.com
helloames.com helloames.com
helloapex.com helloapex.com
hellobainbridgeisland.com hellobainbridgeisland.com
hellobaker.com hellobaker.com
helloballwin.com helloballwin.com
hellobarberton.com hellobarberton.com
hellobattleground.com hellobattleground.com
hellobeloit.com hellobeloit.com
helloberkeley.com helloberkeley.com
hellobethany.com hellobethany.com
hellobeverly.com hellobeverly.com
hellobourbonnais.com hellobourbonnais.com
hellobradford.com hellobradford.com
helloburnsville.com helloburnsville.com
hellobutte.com hellobutte.com
hellocanberra.com hellocanberra.com
hellochaska.com hellochaska.com
hellocleburne.com hellocleburne.com
helloclifton.com helloclifton.com
helloclinton.com helloclinton.com
hellocuyahogafalls.com hellocuyahogafalls.com
hellodakar.com hellodakar.com
hellodarwin.com hellodarwin.com
hellodickinson.com hellodickinson.com
hellodowney.com hellodowney.com
hellodraper.com hellodraper.com
helloearth.com helloearth.com
helloelizabeth.com helloelizabeth.com
hellofairviewheights.com hellofairviewheights.com
hellofarragut.com hellofarragut.com
hellogiza.com hellogiza.com
hellogladstone.com hellogladstone.com
hellogodfrey.com hellogodfrey.com
hellogoosecreek.com hellogoosecreek.com
hellogrenadines.com hellogrenadines.com
hellohampton.com hellohampton.com
helloharkerheights.com helloharkerheights.com
hellohastings.com hellohastings.com
hellohenderson.com hellohenderson.com
hellohobbs.com hellohobbs.com
hellohudson.com hellohudson.com
helloirving.com helloirving.com
hellojos.com hellojos.com
hellojurupavalley.com hellojurupavalley.com
hellolacanadaflintridge.com hellolacanadaflintridge.com
hellolakewood.com hellolakewood.com
hellolanghorne.com hellolanghorne.com
helloleaguecity.com helloleaguecity.com
hellolewisville.com hellolewisville.com
hellomadras.com hellomadras.com
hellomaricopa.com hellomaricopa.com
hellomarrakech.com hellomarrakech.com
hellomarshall.com hellomarshall.com
hellomassapequapark.com hellomassapequapark.com
hellomayfieldheights.com hellomayfieldheights.com
hellomckeesport.com hellomckeesport.com
hellomckinney.com hellomckinney.com
hellomelrosepark.com hellomelrosepark.com
hellomendotaheights.com hellomendotaheights.com
hellomenomoneefalls.com hellomenomoneefalls.com
hellomiamisburg.com hellomiamisburg.com
hellomiddle.com hellomiddle.com
hellomissionviejo.com hellomissionviejo.com
hellomoline.com hellomoline.com
hellomonroe.com hellomonroe.com
hellonapavalley.com hellonapavalley.com
hellonationalcity.com hellonationalcity.com
hellonewiberia.com hellonewiberia.com
hellooaklawnvillage.com hellooaklawnvillage.com
hellooceanside.com hellooceanside.com
helloolivebranch.com helloolivebranch.com
hellopaducah.com hellopaducah.com
hellopocatello.com hellopocatello.com
hellopontiac.com hellopontiac.com
helloportsainttlucie.com helloportsainttlucie.com
helloportsmouth.com helloportsmouth.com
helloprescott.com helloprescott.com
helloroundlakebeach.com helloroundlakebeach.com
hellorwanda.com hellorwanda.com
hellosantapaula.com hellosantapaula.com
hellosantee.com hellosantee.com
helloschaumburg.com helloschaumburg.com
helloschenectady.com helloschenectady.com
hellosheffield.com hellosheffield.com
helloshenyang.com helloshenyang.com
helloshorewood.com helloshorewood.com
hellosofia.com hellosofia.com
hellosouthmilwaukee.com hellosouthmilwaukee.com
hellosparks.com hellosparks.com
hellotuscaloosa.com hellotuscaloosa.com
hellounion.com hellounion.com
hellovincennes.com hellovincennes.com
hellowarnerrobins.com hellowarnerrobins.com
hellowarren.com hellowarren.com
hellowashington.com hellowashington.com
hellowestmemphis.com hellowestmemphis.com
hellowestsacramento.com hellowestsacramento.com
hellowhitewater.com hellowhitewater.com
hellowintergarden.com hellowintergarden.com
hellowoodbridge.com hellowoodbridge.com
hellowyoming.com hellowyoming.com
helloyolo.com helloyolo.com
hellozanesville.com hellozanesville.com
hertsadvertisersundayfl.co.uk hertsadvertisersundayfl.co.uk
hhcardinals.com hhcardinals.com
hhcomets.com hhcomets.com
hhshawksnest.com hhshawksnest.com
hhsmustangathletics.org hhsmustangathletics.org
hibernian-mad.co.uk hibernian-mad.co.uk
hilandathletics.com hilandathletics.com
hillgroveathletics.com hillgroveathletics.com
hockeyfights.com hockeyfights.com
hopkinsathletics.com hopkinsathletics.com
horizonprimarype.com horizonprimarype.com
hot1073jamz.com hot1073jamz.com
houndnation1.com houndnation1.com
howemilitaryathletics.org howemilitaryathletics.org
howlinhockey.com howlinhockey.com
hseroyalsathletics.com hseroyalsathletics.com
hwhswildcats.com hwhswildcats.com
hzxtjdz.com hzxtjdz.com
iheartcats.com iheartcats.com
ilateral.com ilateral.com
illianachristianvikings.com illianachristianvikings.com
imagenradio.com.mx imagenradio.com.mx
imp.center imp.center
insidehoops.com insidehoops.com
iwkprohockeydraft.com iwkprohockeydraft.com
izismile.com izismile.com
jacketathletics.com jacketathletics.com
jantakiawaz.org jantakiawaz.org
jcpatriotsathletics.com jcpatriotsathletics.com
jellyz.live jellyz.live
jeromeathletics.net jeromeathletics.net
jfoot1969.co.uk jfoot1969.co.uk
jimtownathletics.org jimtownathletics.org
johnadamsathletics.com johnadamsathletics.com
johnmarshallathletics.org johnmarshallathletics.org
joshuaathletics.com joshuaathletics.com
jrvikingssoftball.com jrvikingssoftball.com
juabwasps.com juabwasps.com
justblogbaby.com justblogbaby.com
katsfm.com katsfm.com
kdat.com kdat.com
keenanraiders.com keenanraiders.com
keepingitheel.com keepingitheel.com
kentvalleyjfl.co.uk kentvalleyjfl.co.uk
keynshamhockeyleague.org.uk keynshamhockeyleague.org.uk
kffirebirds.com kffirebirds.com
kicks1055.com kicks1055.com
killerfrogs.com killerfrogs.com
kilmarnock-mad.co.uk kilmarnock-mad.co.uk
king-mag.com king-mag.com
king5.com king5.com
kisscasper.com kisscasper.com
kmlchargers.com kmlchargers.com
knightspride.com knightspride.com
ndhsbulldogathletics.com ndhsbulldogathletics.com
ndhsrebels.com ndhsrebels.com
kool965.com kool965.com
krna.com krna.com
kushnercobras.com kushnercobras.com
laacibnet.net laacibnet.net
lapelathletics.com lapelathletics.com
lasportshub.com lasportshub.com
lavilleathletics.com lavilleathletics.com
leedsunited-mad.co.uk leedsunited-mad.co.uk
leoboivinshowcase.ca leoboivinshowcase.ca
livingmgz.com livingmgz.com
ljvikings.com ljvikings.com
lmshs-lions.com lmshs-lions.com
loadoutroom.com loadoutroom.com
lobonation.com lobonation.com
logancountyathletics.com logancountyathletics.com
logangrizzlies.org logangrizzlies.org
looper.com looper.com
loopjamaica.com loopjamaica.com
loopslu.com loopslu.com
losandes.com.ar losandes.com.ar
lostandtaken.com lostandtaken.com
louisvuittonbag.net louisvuittonbag.net
lqathletics.com lqathletics.com
lsfa.co.uk lsfa.co.uk
lutheranathletics.org lutheranathletics.org
mahshl.com mahshl.com
manchesterunited-mad.co.uk manchesterunited-mad.co.uk
maroonandwhitenation.com maroonandwhitenation.com
mashed.com mashed.com
masonbulldogsports.com masonbulldogsports.com
mcdonoughathletics.com mcdonoughathletics.com
mdchscrusaderathletics.com mdchscrusaderathletics.com
meadowcreekathletics.org meadowcreekathletics.org
medcitynews.com medcitynews.com
media1.hellometro.com media1.hellometro.com
melanieredd.com melanieredd.com
memedroid.com memedroid.com
mentertained.com mentertained.com
mhspolarbearathletics.com mhspolarbearathletics.com
mid-day.com mid-day.com
midcurrent.com midcurrent.com
necbl.com necbl.com
milandawgs.com milandawgs.com
milehighmaniac.com milehighmaniac.com
mineralcountyminer.com mineralcountyminer.com
mix931fm.com mix931fm.com
mlbreports.tv mlbreports.tv
moblivious.com moblivious.com
modernmuzzleloader.com modernmuzzleloader.com
mommyneedsvodka.com mommyneedsvodka.com
momsrow.com momsrow.com
moonareaathletics.com moonareaathletics.com
morningjournal.com morningjournal.com
moviemistakes.com moviemistakes.com
mshstrojanathletics.com mshstrojanathletics.com
mtairynews.com mtairynews.com
multiculturalyp.com multiculturalyp.com
mvmavericks.com mvmavericks.com
mvwildcats.com mvwildcats.com
mydallaspost.com mydallaspost.com
myha.org myha.org
mytinschi.de mytinschi.de
nbaanalysis.net nbaanalysis.net
nbagamesim.com nbagamesim.com
nbgha.com nbgha.com
news-herald.com news-herald.com
newstalk870.am newstalk870.am
newsy.com newsy.com
nextstephockey.com nextstephockey.com
nmblacktornadosports.com nmblacktornadosports.com
northviewsports.com northviewsports.com
nshahsathletics.com nshahsathletics.com
nutleyathletics.org nutleyathletics.org
nybeachcams.com nybeachcams.com
ocoeeathletics.com ocoeeathletics.com
odcsathletics.org odcsathletics.org
odemowlathletics.com odemowlathletics.com
ohspiratesathletics.com ohspiratesathletics.com
oilonwhyte.com oilonwhyte.com
okemosathletics.net okemosathletics.net
oldielyrics.com oldielyrics.com
olentangylibertyathletics.com olentangylibertyathletics.com
olneycharterathletics.com olneycharterathletics.com
olympiahighschoolathletics.com olympiahighschoolathletics.com
onvideo.org onvideo.org
ooyyo.com ooyyo.com
orovillemr.com orovillemr.com
osseo-orioles.com osseo-orioles.com
otroligtbra.se otroligtbra.se
ourlads.com ourlads.com
ovidelsiesports.com ovidelsiesports.com
paradisepost.com paradisepost.com
passaicvalleyathletics.com passaicvalleyathletics.com
pchsathletics.com pchsathletics.com
pcrecordtimes.com pcrecordtimes.com
pebblebrookathletics.com pebblebrookathletics.com
pembinavalleymha.com pembinavalleymha.com
pembrokeshireleague.co.uk pembrokeshireleague.co.uk
pflsports.net pflsports.net
phimso1.us phimso1.us
phlaleagues.ca phlaleagues.ca
phsbulldogsathletics.org phsbulldogsathletics.org
pikecentralathletics.com pikecentralathletics.com
pikeroadathletics.org pikeroadathletics.org
pinckneypiratesathletics.com pinckneypiratesathletics.com
pistonpowered.com pistonpowered.com
plattepirates.org plattepirates.org
pleasantonathletics.com pleasantonathletics.com
pmawarriorsathletics.com pmawarriorsathletics.com
poe.trade poe.trade
poetsathletics.com poetsathletics.com
poresto.net poresto.net
pottershousepumas.com pottershousepumas.com
powdersvillepatriotathletics.com powdersvillepatriotathletics.com
predominantlyorange.com predominantlyorange.com
prhslions.com prhslions.com
primiciasya.com primiciasya.com
priuschat.com priuschat.com
prosportsdaily.com prosportsdaily.com
pucksofafeather.com pucksofafeather.com
purcellmarianathletics.org purcellmarianathletics.org
pvathletics.com pvathletics.com
pvhsathletics.com pvhsathletics.com
pwpodcasts.com pwpodcasts.com
qmusica.tv qmusica.tv
queensparkrangers-mad.co.uk queensparkrangers-mad.co.uk
radio.com radio.com
radiopup.com radiopup.com
randolphathletics.net randolphathletics.net
rattlernationathletics.com rattlernationathletics.com
ravennaathletics.us ravennaathletics.us
ravennabulldogsathletics.com ravennabulldogsathletics.com
rcunited.ca rcunited.ca
readersdigest.ca readersdigest.ca
rebootplatform.info rebootplatform.info
redanhighathletics.com redanhighathletics.com
redrants.com redrants.com
reeths-pufferathletics.com reeths-pufferathletics.com
referatele.com referatele.com
reporterherald.com reporterherald.com
rhymejunkie.com rhymejunkie.com
riflehighschoolsports.com riflehighschoolsports.com
rihannasnavy.com rihannasnavy.com
rinkroyalty.com rinkroyalty.com
ripbladehockeyeast.com ripbladehockeyeast.com
rivergrandrapids.com rivergrandrapids.com
HELLOQUEENSTOWN.COM
IP History

Click the IP addresses to see over domains using them.