Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

CLIENT.CREPHOTOS.COM

CLIENT.CREPHOTOS.COM
Shared Attributes
Domain
craigsauer3d.com sites.craigsauer3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 112 days
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
coremarketingconcepts.com sites.coremarketingconcepts.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 112 days
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
craigbernardi.com sites.craigbernardi.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 112 days
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
creativeinitiativeatl.com login.creativeinitiativeatl.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Dec 2022 One Off
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
comehometotheone.com comehometotheone.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 One Off
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
comehomeinwestseattle.com comehomeinwestseattle.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
belmontnorthstar.com belmontnorthstar.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
comehometolakestevens.com comehometolakestevens.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
berkeleyduplex.info berkeleyduplex.info
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
birdway.net birdway.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bestofolinda.com bestofolinda.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
comingsoon2soldbyvp.com comingsoon2soldbyvp.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
beverlyhillsnewlisting.com beverlyhillsnewlisting.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
cortinaqueencreek.com cortinaqueencreek.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
covingtonwahome.com covingtonwahome.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
covingtonrambler.com covingtonrambler.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bluelakehideout.com bluelakehideout.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bouldercreekcharmer.com bouldercreekcharmer.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
brawleyparksuites.com brawleyparksuites.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bridletrailsmidcentury.com bridletrailsmidcentury.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bouldercreekestate.com bouldercreekestate.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
buildsouthaustin.com buildsouthaustin.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
buylegatocorner.com buylegatocorner.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
condoindecatur.com condoindecatur.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
benlomondriverfront.com benlomondriverfront.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
berkeleyhillshomes.com berkeleyhillshomes.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
continuum3206.com continuum3206.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bestofhaiku.com bestofhaiku.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
contracostaliving.info contracostaliving.info
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
copperbendaz.com copperbendaz.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
cordovaqueencreek.com cordovaqueencreek.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
biddledonedeal.com biddledonedeal.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
cornell306.com cornell306.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
cornell304.com cornell304.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
coronadomedia.net sites.coronadomedia.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bigtreefarmestate.com bigtreefarmestate.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
corona-heights.com corona-heights.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
countrycluboflandfallhomes.com countrycluboflandfallhomes.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
cowhollowviews.com cowhollowviews.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
cozyinshelton.com cozyinshelton.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bonitabutternut.com bonitabutternut.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
boornbrook.com boornbrook.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
creekside8.com creekside8.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bouldercreekgem.com bouldercreekgem.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
crestviewcool.com crestviewcool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
breezyriverranch.com breezyriverranch.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bridgetonnorth.com bridgetonnorth.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
btn-recycle.com btn-recycle.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
buriencharmer.com buriencharmer.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
comftycrashpad.com comftycrashpad.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
lupinlodgeoflosgatos.com lupinlodgeoflosgatos.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bellagioway.com bellagioway.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
constancegauthier.com clients.constancegauthier.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bellevuepenthouse.com bellevuepenthouse.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
continuum3601.com continuum3601.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bestofnoevalley.com bestofnoevalley.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
contemporaryonlakemarblefalls.com contemporaryonlakemarblefalls.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
copperbendqueencreek.com copperbendqueencreek.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bigviewonlakeaustin.com bigviewonlakeaustin.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
cornhusklane.com cornhusklane.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
billfishmodel.com billfishmodel.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
cortesiopenhouse15.com cortesiopenhouse15.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bishopneighborhood.com bishopneighborhood.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
countryranchette.com countryranchette.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
cover3ranch.com cover3ranch.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
coveredbridgeunit50.com coveredbridgeunit50.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bobwireroad.com bobwireroad.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bond816.com bond816.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
boston-street.com boston-street.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
crestonviews.com crestonviews.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
crisppark.com crisppark.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bridgeviewcondos.com bridgeviewcondos.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
brookhavencastle.com brookhavencastle.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
buenavistaranchtx.com buenavistaranchtx.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
buildinbrighton.com buildinbrighton.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
buildonlakeaustin.com buildonlakeaustin.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
buttonwoodbayd2.com buttonwoodbayd2.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
condoonthecourse.com condoonthecourse.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
condoonpage.com condoonpage.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
belvedereestate.com belvedereestate.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
beresfordcharmer.com beresfordcharmer.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
berkeleycondo.info berkeleycondo.info
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
berkeleyskylair.com berkeleyskylair.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
continuumn2703.com continuumn2703.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bertonleyave.com bertonleyave.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
coronadoterrace.com coronadoterrace.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
corteramonview.com corteramonview.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bontonapeninsula.com bontonapeninsula.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
creeksidegemissaquah.com creeksidegemissaquah.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
creekbeachliving.com creekbeachliving.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
crestcorridor.com crestcorridor.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
bradentonbusinesspark.com bradentonbusinesspark.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
crocker-amazon.com crocker-amazon.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
broadmeadowvt.com broadmeadowvt.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
brooktreeranchroad.com brooktreeranchroad.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
burbankcollection302.com burbankcollection302.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
butterfieldestate.com butterfieldestate.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
UA UA-63029412 Feb 2025 Feb 2025 One Off
fdimedia.com listing.fdimedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 332 days
otbxair.com listing.otbxair.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 86 days
aerialcanvas.com listings.aerialcanvas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 105 days
axtonandliv.com listings.axtonandliv.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 55 days
docprops.com listings.docprops.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 62 days
grmedia.ca listings.grmedia.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 May 2023 39 days
realtyexecutivesbw.com listings.realtyexecutivesbw.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 36 days
snapsharks.com listings.snapsharks.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 97 days
thergbstudios.com listings.thergbstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 99 days
vastmediaspace.com listings.vastmediaspace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 101 days
westrobin.com listings.westrobin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 102 days
aperturemedia.io live.aperturemedia.io
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 107 days
kuperrealty.com live.kuperrealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 104 days
luxehomestyles.com luxehomestyles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 194 days
lwvhome.com lwvhome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 21 days
madrone118.com madrone118.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 108 days
cincyvisuals.com media.cincyvisuals.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Apr 2024 1 year, 23 days
homesellerstudio.com media.homesellerstudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Jan 2023 One Off
openhouse360.com media.openhouse360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 86 days
remco.solutions media.remco.solutions
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Mar 2024 308 days
estatephotos.la mylisting.estatephotos.la
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 332 days
orion3dstudios.com myspaceport.orion3dstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 86 days
ranchobuenavidatexas.com ranchobuenavidatexas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 58 days
richlonardo.com pages.richlonardo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2023 63 days
palmiahomesforsale.com palmiahomesforsale.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 131 days
lresmarketing.com photos.lresmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 101 days
scrug.gs portfolio.scrug.gs
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 94 days
aspectvisuals.co properties.aspectvisuals.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 53 days
lumifulmedia.com properties.lumifulmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Sep 2023 40 days
shftgroup.ca properties.shftgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 225 days
spectrumrealestatephotography.com properties.spectrumrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 41 days
jdpworks.com remedia.jdpworks.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 74 days
rent1313sealway.com rent1313sealway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 182 days
scenicdriveestate.com scenicdriveestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Mar 2024 109 days
seasidepearlfarmgatewinery.info seasidepearlfarmgatewinery.info
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 180 days
adioimages.com sites.adioimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 105 days
allmediatours.com sites.allmediatours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 106 days
ardentmediagroup.ca sites.ardentmediagroup.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Apr 2024 319 days
austinlistingphotos.com sites.austinlistingphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Nov 2023 241 days
bluebruinphotography.com sites.bluebruinphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Oct 2023 288 days
changeovermedia.com sites.changeovermedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 111 days
discoveraerial.com sites.discoveraerial.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 62 days
elevatedphotos.ca sites.elevatedphotos.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 331 days
firelightimages.com sites.firelightimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 67 days
flywithsas.com sites.flywithsas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 67 days
fullbarsmedia.com sites.fullbarsmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Mar 2024 218 days
gestaltgroup.com sites.gestaltgroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Mar 2024 99 days
helicopix.com sites.helicopix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 71 days
highfivemediapro.com sites.highfivemediapro.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 71 days
homelaunch.ca sites.homelaunch.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 72 days
jpmrealestatephotography.com sites.jpmrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 75 days
lunghistudio.com sites.lunghistudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 103 days
matthewjamesphoto.ca sites.matthewjamesphoto.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 80 days
odyssey3d.ca sites.odyssey3d.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 85 days
realtronaccelerate.ca sites.realtronaccelerate.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 91 days
relahqdemo.com sites.relahqdemo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 91 days
ruummedia.com sites.ruummedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Mar 2024 347 days
siliconvalleyphotos.com sites.siliconvalleyphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 96 days
sjvirtualtours.ca sites.sjvirtualtours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 96 days
taftpix.com sites.taftpix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 42 days
taylorallancreative.com sites.taylorallancreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 98 days
tracycolburn.com sites.tracycolburn.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Oct 2023 280 days
uniquemediadesign.com sites.uniquemediadesign.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 104 days
wtcreative.com sites.wtcreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 103 days
104mirasolct.com 104mirasolct.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Sep 2023 One Off
1142nvenetiandr.com 1142nvenetiandr.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 8 days
123iconstreet.com 123iconstreet.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 104 days
145robbyln.com 145robbyln.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 61 days
stonewellcourt.com stonewellcourt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 56 days
theoutpostestate.com theoutpostestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 198 days
api360.ca tour.api360.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 107 days
castlerealestatemarketing.com tour.castlerealestatemarketing.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2023 87 days
benaccinelli.com tours.benaccinelli.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 104 days
curb360.com tours.curb360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 328 days
vogelcreative.ca tours.vogelcreative.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 101 days
veeshome.com veeshome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 231 days
casadirame.com casadirame.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 216 days
brubeckhouse.com brubeckhouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 188 days
casaonpennell.com casaonpennell.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Apr 2024 152 days
aw360.me my.aw360.me
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Feb 2024 296 days
captivateproductions.org client.captivateproductions.org
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Sep 2023 61 days
designerhomestyles.com designerhomestyles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Apr 2024 145 days
glass7thfloor.com glass7thfloor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 109 days
harecreekterrace.com harecreekterrace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 61 days
historiccromwellestate.com historiccromwellestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Sep 2023 One Off
hometour.me hometour.me
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 335 days
innerrichmondduplex.com innerrichmondduplex.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 24 days
liamlatin.com liamlatin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 196 days
lincolnparklawnlust.com lincolnparklawnlust.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 138 days
elevatedlistingstx.com listings.elevatedlistingstx.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Jan 2024 285 days
focus-rep.com listings.focus-rep.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Oct 2023 81 days
ground2airmedia.com listings.ground2airmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jan 2024 1 year, 17 days
mattpiercephoto.com listings.mattpiercephoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Dec 2023 342 days
nextdoorphotos.com listings.nextdoorphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jan 2024 1 year, 31 days
photoreal.ca listings.photoreal.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 88 days
pixerpros.com listings.pixerpros.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2023 109 days
relawldemo.com listings.relawldemo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 91 days
sitesforproperties.com listings.sitesforproperties.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Aug 2023 171 days
dynamictours.ca login.dynamictours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2024 Feb 2024 52 days
focus-rep.com login.focus-rep.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 May 2023 One Off
goosemediagroup.com login.goosemediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 69 days
hrantmedia.com login.hrantmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Aug 2023 219 days
joshmeyerfilms.com login.joshmeyerfilms.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2023 Jun 2023 One Off
skyrealtymedia.com login.skyrealtymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jan 2023 21 days
revedio.com myrevedio.revedio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 92 days
palmiahomeforsale.com palmiahomeforsale.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 18 days
laidlawphotography.com photos.laidlawphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Dec 2023 239 days
aremacphotography.com portal.aremacphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 107 days
lalush.com properties.lalush.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Dec 2023 339 days
ranchesatsentinelpeaktract3.com ranchesatsentinelpeaktract3.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 54 days
ritzcarltonvilla810.com ritzcarltonvilla810.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Mar 2024 108 days
aresortwithinaresort.com aresortwithinaresort.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jan 2023 33 days
castrocondo.com castrocondo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 110 days
photographervince.com agent.photographervince.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Nov 2023 One Off
artesiantitle.com sites.artesiantitle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Oct 2023 286 days
capturereality.io sites.capturereality.io
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Apr 2024 348 days
crossroadsrealtynj.com sites.crossroadsrealtynj.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jun 2023 159 days
dreamhomeimages.com sites.dreamhomeimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 63 days
elevatovisuals.com sites.elevatovisuals.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 331 days
fullframecreativeagency.com sites.fullframecreativeagency.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 104 days
genesisvue.com sites.genesisvue.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 68 days
happyhousegta.com sites.happyhousegta.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Nov 2023 240 days
jdmontero.com sites.jdmontero.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Sep 2023 262 days
jmphilms.com sites.jmphilms.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 75 days
kianikanstudio.ca sites.kianikanstudio.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 139 days
liftecmedia.com sites.liftecmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2023 Mar 2024 270 days
listvt.com sites.listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 92 days
lounny.com sites.lounny.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 99 days
mshaltout-realphotography.com sites.mshaltout-realphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Aug 2023 227 days
realtoursswfl.com sites.realtoursswfl.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 91 days
reel2realestates.com sites.reel2realestates.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Sep 2023 273 days
richmountcreative.com sites.richmountcreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Mar 2024 1 year, 73 days
royaltystudios.co sites.royaltystudios.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 93 days
shutterlist.com sites.shutterlist.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 96 days
slevinhurtado.com sites.slevinhurtado.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Apr 2024 148 days
snapairphoto.com sites.snapairphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 97 days
southbaypics.com sites.southbaypics.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 97 days
virtualview360.com sites.virtualview360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 101 days
walters.photography sites.walters.photography
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Apr 2024 270 days
willventuresphoto.com sites.willventuresphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 102 days
skye30a.com skye30a.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Apr 2024 164 days
1077rankin.com 1077rankin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 164 days
13908hutchinsonplace.com 13908hutchinsonplace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Dec 2023 One Off
150orleans510.com 150orleans510.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Sep 2023 One Off
stonecrestlaketahoe.com stonecrestlaketahoe.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 112 days
verticalmediatx.com agent.verticalmediatx.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 131 days
surfclub410.com surfclub410.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 14 days
thehomeonvashon.com thehomeonvashon.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 173 days
themusehouse.com themusehouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 173 days
theoneinseattle.com theoneinseattle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 126 days
chadjonesphoto.com tour.chadjonesphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 59 days
digenovamedia.ca tour.digenovamedia.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Jan 2024 284 days
shutterhouse.ca tour.shutterhouse.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Apr 2024 1 year, 32 days
augmentum.ca virtualtours.augmentum.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 227 days
brussels-st.com brussels-st.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Sep 2023 260 days
28photos.com realestate.28photos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 104 days
topdownphotos.com my.topdownphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 55 days
784design.com client.784design.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Apr 2024 1 year, 75 days
benson-productions.com client.benson-productions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jan 2023 35 days
redheiferproductions.com clientportal.redheiferproductions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 128 days
coastalhometours.com clients.coastalhometours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 May 2023 128 days
coastalrealestatemedia.com clients.coastalrealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Apr 2024 274 days
glass9thfloor.com glass9thfloor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 33 days
grandsummitranch.com grandsummitranch.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 112 days
teamcirca.com homes.teamcirca.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Apr 2024 348 days
imperialhousephb.com imperialhousephb.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 30 days
spectrumrealestatephotography.com remaxadvance.spectrumrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 41 days
acreagehomeinredmond.com acreagehomeinredmond.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Dec 2023 111 days
seasidesandsinnmotel.com seasidesandsinnmotel.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 180 days
aimagery.com site.aimagery.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 106 days
aeriousplus.com sites.aeriousplus.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 105 days
brownbear-productions.com sites.brownbear-productions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 May 2023 126 days
calrealestatemedia.com sites.calrealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 110 days
curbviews.com sites.curbviews.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Feb 2024 296 days
davewarren.net sites.davewarren.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Sep 2023 251 days
digitalhometours.ca sites.digitalhometours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 135 days
discovervirtual360.com sites.discovervirtual360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 62 days
dronehomemedia.com sites.dronehomemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 63 days
dustinclyde.com sites.dustinclyde.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 63 days
housepics4u.ca sites.housepics4u.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 72 days
ictimaging.com sites.ictimaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 217 days
inhabitphotography.com sites.inhabitphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 73 days
intextphotography.com sites.intextphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 73 days
itsrealestatepropertyservices.com sites.itsrealestatepropertyservices.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Jan 2024 289 days
keesnap.com sites.keesnap.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 39 days
megmediagroup.com sites.megmediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Mar 2024 1 year, 68 days
nausetmedia.com sites.nausetmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 84 days
njpropertypix.com sites.njpropertypix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 37 days
ospreymediaalliance.com sites.ospreymediaalliance.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Apr 2023 One Off
pantheraaerial.com sites.pantheraaerial.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2023 Mar 2024 1 year, 28 days
pdxdan.com sites.pdxdan.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jan 2024 1 year, 34 days
porticomedia.net sites.porticomedia.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 89 days
primeremedia.net sites.primeremedia.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 89 days
radiantphotovideo.com sites.radiantphotovideo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Mar 2024 346 days
refleximaging.com sites.refleximaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 91 days
seattleprophotography.com sites.seattleprophotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 94 days
sfvt.us sites.sfvt.us
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2023 112 days
shadowpointmedia.com sites.shadowpointmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Mar 2024 1 year, 31 days
showingaustin.com sites.showingaustin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Feb 2024 292 days
staceyhennessy.com sites.staceyhennessy.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 97 days
trifectamediasd.com sites.trifectamediasd.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 316 days
virtourmedia.com sites.virtourmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 101 days
virtualviewtours.com sites.virtualviewtours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2023 73 days
vmdpros.com sites.vmdpros.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 One Off
youngrealtymedia.com sites.youngrealtymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 107 days
avegbythesea.com avegbythesea.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
10021686west13avenue.com 10021686west13avenue.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 33 days
103fairviewchurch.com 103fairviewchurch.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 62 days
106-bixby-hill.com 106-bixby-hill.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 62 days
129turnberryway.com 129turnberryway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 33 days
12jacquelineroadunitc.com 12jacquelineroadunitc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Dec 2023 112 days
1507mefferdave.com 1507mefferdave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 70 days
bcpoverlook.com bcpoverlook.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jun 2023 167 days
amazinglistingphotos.com tour.amazinglistingphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 107 days
virtualrevolutionllc.com tour.virtualrevolutionllc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 101 days
zipp3d.com tours.zipp3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 103 days
bigtamview.com bigtamview.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 189 days
vannnoord.com vannnoord.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 196 days
luxoriginal.com virtualtours.luxoriginal.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Oct 2023 164 days
toddsfotos.com vtours.toddsfotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 100 days
igm-realestate.com booking.igm-realestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Mar 2024 101 days
arborvisualmedia.com websites.arborvisualmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 107 days
buybuchanen.com buybuchanen.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 111 days
canariasdoral4439nw81ave.com canariasdoral4439nw81ave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 65 days
victoriarealestatemarketing.tv s.victoriarealestatemarketing.tv
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 101 days
fullframehometours.com client.fullframehometours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 68 days
huscp.com client.huscp.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Mar 2024 341 days
seancarrie.com client.seancarrie.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Mar 2024 1 year, 30 days
moorestudios.com clients.moorestudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 141 days
goldcanyonazland.com goldcanyonazland.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 24 days
grandlakevilla.com grandlakevilla.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 204 days
greenfielddr.com greenfielddr.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 204 days
venturesir.com home.venturesir.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 101 days
dallaspro.com homes.dallaspro.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 112 days
aftertecai.com hostedby.aftertecai.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 105 days
imperialhousepha.com imperialhousepha.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 30 days
lakeforestparkmidcenturygem.com lakeforestparkmidcenturygem.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 138 days
letitacrest.com letitacrest.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 87 days
mhv.co listedhq.mhv.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 81 days
im3rdmedia.com listing.im3rdmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 72 days
invznmedia.com listing.invznmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 73 days
listing.pics listing.pics
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2023 Aug 2023 57 days
listing4.com listing4.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 91 days
alleganymedia.com listings.alleganymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 323 days
allieweaverinteriors.com listings.allieweaverinteriors.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 323 days
demophotog.com listings.demophotog.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Apr 2024 348 days
denpg.com listings.denpg.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 61 days
dfwvt.com listings.dfwvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 62 days
framexstudio.com listings.framexstudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Mar 2024 1 year, 62 days
gregsilvaphotography.com listings.gregsilvaphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 May 2023 134 days
paidtogether.com listings.paidtogether.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 87 days
revolrealestate.com listings.revolrealestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Mar 2024 347 days
splicerealty.com listings.splicerealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 One Off
atozmedia.ca login.atozmedia.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 One Off
jfarrismedia.com login.jfarrismedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2024 Mar 2024 53 days
swetnammedia.com login.swetnammedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 May 2023 One Off
russlyon.com lux.russlyon.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Nov 2023 291 days
lwdreamhome.com lwdreamhome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 106 days
propermeasure.com media.propermeasure.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 90 days
movingyouintherightdirection.com movingyouintherightdirection.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 191 days
orion3d.studio myspaceport.orion3d.studio
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 86 days
nurmiisles.com nurmiisles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 207 days
ricoretreat.com ricoretreat.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 75 days
plantationpoimtsouth.com plantationpoimtsouth.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 162 days
johnruzphoto.com portal.johnruzphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Mar 2024 103 days
local-shot.com portal.local-shot.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 96 days
ryanhalseyphotography.com properties.ryanhalseyphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jul 2023 190 days
brookfieldphotographer.com property.brookfieldphotographer.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 109 days
relahq.com relahq.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 112 days
condoinclarksville.com condoinclarksville.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
cousteaulane.com cousteaulane.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025 One Off
thedowntowncreative.com request.thedowntowncreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 99 days
3eyemedia.com sites.3eyemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 104 days
5dgmedia.com sites.5dgmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Dec 2023 119 days
acreagency.com sites.acreagency.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 321 days
architaraphoto.com sites.architaraphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 107 days
beesknees-photography.com sites.beesknees-photography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 105 days
cathykoop.ca sites.cathykoop.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 52 days
csrarealestatephoto.com sites.csrarealestatephoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Sep 2023 251 days
domusvisions.com sites.domusvisions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Dec 2022 2 days
dynamictours.ca sites.dynamictours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Sep 2023 254 days
eastbayrealestatevideos.com sites.eastbayrealestatevideos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 63 days
elevotix.com sites.elevotix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Feb 2024 98 days
explorify3d.com sites.explorify3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 65 days
flylisted.com sites.flylisted.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Mar 2024 217 days
hangtime27.com sites.hangtime27.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2023 Mar 2024 260 days
harmonps.com sites.harmonps.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 71 days
home-views.com sites.home-views.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 72 days
homejab.com sites.homejab.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
i3dtours.com sites.i3dtours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 72 days
limestmedia.com sites.limestmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jan 2024 1 year, 25 days
listing-standard.com sites.listing-standard.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 92 days
mccourtneyphotographics.com sites.mccourtneyphotographics.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 81 days
oneshotprods.com sites.oneshotprods.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 86 days
pdxrealestatetours.com sites.pdxrealestatetours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 88 days
precipitousimaging.com sites.precipitousimaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Mar 2024 107 days
quickcloselistings.com sites.quickcloselistings.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 90 days
realestatemarketing-services.com sites.realestatemarketing-services.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Jan 2023 One Off
realpatience.com sites.realpatience.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 36 days
scatterscape.com sites.scatterscape.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 94 days
skyshotstudios.com sites.skyshotstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 96 days
solpix.co sites.solpix.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 112 days
sparksmediagroup.com sites.sparksmediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 97 days
tcvtours3d.com sites.tcvtours3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 98 days
trueonegroup.com sites.trueonegroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 100 days
trueperceptionimages.com sites.trueperceptionimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 100 days
vantagemediaproductions.com sites.vantagemediaproductions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 One Off
visionnj.com sites.visionnj.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 47 days
assemblyliving.com assemblyliving.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 112 days
10979chalonroad.net 10979chalonroad.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 226 days
1234address.com 1234address.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 218 days
lunghimediagroup.com templates.lunghimediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 103 days
higginbothammedia.com tour.higginbothammedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 May 2023 134 days
seacoastrephotography.com tour.seacoastrephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 94 days
amazingphotovideo.com tours.amazingphotovideo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 323 days
blueoceanmiami.com tours.blueoceanmiami.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 109 days
caldecott.com tours.caldecott.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jan 2023 30 days
dronetoursllc.com tours.dronetoursllc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Feb 2024 337 days
justaskjask.com tours.justaskjask.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 75 days
newvisionstudio.com tours.newvisionstudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 112 days
photoconnor.com tours.photoconnor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 88 days
srq360media.com tours.srq360media.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 97 days
vrsquadinc.com tours.vrsquadinc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 102 days
vividvm.com user.vividvm.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Feb 2024 339 days
c21colonial.ca virtualtour.c21colonial.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jan 2024 1 year, 6 days
westgissingroad.com westgissingroad.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 195 days
listvt.com u.listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 92 days
goproptech.com client.goproptech.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2023 Feb 2023 One Off
cre8r.agency clients.cre8r.agency
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 52 days
jackvatcherphotography.com clients.jackvatcherphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Jan 2024 1 year, 21 days
islandsothebysrealty.com featured.islandsothebysrealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 104 days
btwimages.com homes.btwimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 104 days
ejp.photo homes.ejp.photo
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 64 days
motioncitymedia.com homes.motioncitymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 104 days
irownwoodcrossingqc.com irownwoodcrossingqc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Dec 2023 One Off
kensingtontic.com kensingtontic.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 198 days
listedhq.com listedhq.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 91 days
growthehive.com listing.growthehive.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2023 95 days
hiverealestatemedia.com listing.hiverealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2023 Mar 2024 261 days
morrisonteam.com listing.morrisonteam.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 83 days
trevisuality.com listing.trevisuality.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 100 days
bokomedia.com listings.bokomedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Oct 2023 82 days
homevideorealestate.com listings.homevideorealestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Nov 2023 335 days
picpros.ca listings.picpros.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 89 days
zuwerksphotography.com listings.zuwerksphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 103 days
listvt.com listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 92 days
aimmedia.group login.aimmedia.group
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Apr 2024 1 year, 75 days
treefort-media.com login.treefort-media.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 100 days
lwopenhouse.com lwopenhouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024 1 year, 112 days
the3rdeye.ca mysite.the3rdeye.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Apr 2023 One Off
oldesouthva.com oldesouthva.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 19 days
scherbamedia.com properties.scherbamedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2024 1 year, 94 days
CLIENT.CREPHOTOS.COM
Non IP Attributes
Attribute First Last
IC IC-ZN9P6ZWJ Dec 2022 Apr 2024
UA UA-63029412 Feb 2025 Feb 2025
NR NR-NRJS-D442BC6A350674E5ABB Feb 2025 Feb 2025
CLIENT.CREPHOTOS.COM
Overlap Attribute Domains
sites.craigsauer3d.com sites.craigsauer3d.com
sites.coremarketingconcepts.com sites.coremarketingconcepts.com
client.crephotos.com client.crephotos.com
sites.craigbernardi.com sites.craigbernardi.com
login.creativeinitiativeatl.com login.creativeinitiativeatl.com
comehometotheone.com comehometotheone.com
comehomeinwestseattle.com comehomeinwestseattle.com
belmontnorthstar.com belmontnorthstar.com
comehometolakestevens.com comehometolakestevens.com
berkeleyduplex.info berkeleyduplex.info
birdway.net birdway.net
bestofolinda.com bestofolinda.com
comingsoon2soldbyvp.com comingsoon2soldbyvp.com
beverlyhillsnewlisting.com beverlyhillsnewlisting.com
cortinaqueencreek.com cortinaqueencreek.com
covingtonwahome.com covingtonwahome.com
covingtonrambler.com covingtonrambler.com
bluelakehideout.com bluelakehideout.com
bouldercreekcharmer.com bouldercreekcharmer.com
brawleyparksuites.com brawleyparksuites.com
bridletrailsmidcentury.com bridletrailsmidcentury.com
bouldercreekestate.com bouldercreekestate.com
buildsouthaustin.com buildsouthaustin.com
buylegatocorner.com buylegatocorner.com
condoindecatur.com condoindecatur.com
benlomondriverfront.com benlomondriverfront.com
berkeleyhillshomes.com berkeleyhillshomes.com
continuum3206.com continuum3206.com
bestofhaiku.com bestofhaiku.com
contracostaliving.info contracostaliving.info
copperbendaz.com copperbendaz.com
cordovaqueencreek.com cordovaqueencreek.com
biddledonedeal.com biddledonedeal.com
cornell306.com cornell306.com
cornell304.com cornell304.com
sites.coronadomedia.net sites.coronadomedia.net
bigtreefarmestate.com bigtreefarmestate.com
corona-heights.com corona-heights.com
countrycluboflandfallhomes.com countrycluboflandfallhomes.com
cowhollowviews.com cowhollowviews.com
cozyinshelton.com cozyinshelton.com
bonitabutternut.com bonitabutternut.com
boornbrook.com boornbrook.com
creekside8.com creekside8.com
bouldercreekgem.com bouldercreekgem.com
crestviewcool.com crestviewcool.com
breezyriverranch.com breezyriverranch.com
bridgetonnorth.com bridgetonnorth.com
btn-recycle.com btn-recycle.com
buriencharmer.com buriencharmer.com
comftycrashpad.com comftycrashpad.com
lupinlodgeoflosgatos.com lupinlodgeoflosgatos.com
bellagioway.com bellagioway.com
clients.constancegauthier.com clients.constancegauthier.com
bellevuepenthouse.com bellevuepenthouse.com
continuum3601.com continuum3601.com
bestofnoevalley.com bestofnoevalley.com
contemporaryonlakemarblefalls.com contemporaryonlakemarblefalls.com
copperbendqueencreek.com copperbendqueencreek.com
bigviewonlakeaustin.com bigviewonlakeaustin.com
cornhusklane.com cornhusklane.com
billfishmodel.com billfishmodel.com
cortesiopenhouse15.com cortesiopenhouse15.com
bishopneighborhood.com bishopneighborhood.com
countryranchette.com countryranchette.com
cover3ranch.com cover3ranch.com
coveredbridgeunit50.com coveredbridgeunit50.com
bobwireroad.com bobwireroad.com
bond816.com bond816.com
boston-street.com boston-street.com
crestonviews.com crestonviews.com
crisppark.com crisppark.com
bridgeviewcondos.com bridgeviewcondos.com
brookhavencastle.com brookhavencastle.com
buenavistaranchtx.com buenavistaranchtx.com
buildinbrighton.com buildinbrighton.com
buildonlakeaustin.com buildonlakeaustin.com
buttonwoodbayd2.com buttonwoodbayd2.com
condoonthecourse.com condoonthecourse.com
condoonpage.com condoonpage.com
belvedereestate.com belvedereestate.com
beresfordcharmer.com beresfordcharmer.com
berkeleycondo.info berkeleycondo.info
berkeleyskylair.com berkeleyskylair.com
continuumn2703.com continuumn2703.com
bertonleyave.com bertonleyave.com
coronadoterrace.com coronadoterrace.com
corteramonview.com corteramonview.com
bontonapeninsula.com bontonapeninsula.com
creeksidegemissaquah.com creeksidegemissaquah.com
creekbeachliving.com creekbeachliving.com
crestcorridor.com crestcorridor.com
bradentonbusinesspark.com bradentonbusinesspark.com
crocker-amazon.com crocker-amazon.com
broadmeadowvt.com broadmeadowvt.com
brooktreeranchroad.com brooktreeranchroad.com
burbankcollection302.com burbankcollection302.com
butterfieldestate.com butterfieldestate.com
listing.fdimedia.com listing.fdimedia.com
listing.otbxair.com listing.otbxair.com
listings.aerialcanvas.com listings.aerialcanvas.com
listings.axtonandliv.com listings.axtonandliv.com
listings.docprops.com listings.docprops.com
listings.grmedia.ca listings.grmedia.ca
listings.realtyexecutivesbw.com listings.realtyexecutivesbw.com
listings.snapsharks.com listings.snapsharks.com
listings.thergbstudios.com listings.thergbstudios.com
listings.vastmediaspace.com listings.vastmediaspace.com
listings.westrobin.com listings.westrobin.com
live.aperturemedia.io live.aperturemedia.io
live.kuperrealty.com live.kuperrealty.com
luxehomestyles.com luxehomestyles.com
lwvhome.com lwvhome.com
madrone118.com madrone118.com
media.cincyvisuals.com media.cincyvisuals.com
media.homesellerstudio.com media.homesellerstudio.com
media.openhouse360.com media.openhouse360.com
media.remco.solutions media.remco.solutions
mylisting.estatephotos.la mylisting.estatephotos.la
myspaceport.orion3dstudios.com myspaceport.orion3dstudios.com
ranchobuenavidatexas.com ranchobuenavidatexas.com
pages.richlonardo.com pages.richlonardo.com
palmiahomesforsale.com palmiahomesforsale.com
photos.lresmarketing.com photos.lresmarketing.com
portfolio.scrug.gs portfolio.scrug.gs
properties.aspectvisuals.co properties.aspectvisuals.co
properties.lumifulmedia.com properties.lumifulmedia.com
properties.shftgroup.ca properties.shftgroup.ca
properties.spectrumrealestatephotography.com properties.spectrumrealestatephotography.com
remedia.jdpworks.com remedia.jdpworks.com
rent1313sealway.com rent1313sealway.com
scenicdriveestate.com scenicdriveestate.com
seasidepearlfarmgatewinery.info seasidepearlfarmgatewinery.info
sites.adioimages.com sites.adioimages.com
sites.allmediatours.com sites.allmediatours.com
sites.ardentmediagroup.ca sites.ardentmediagroup.ca
sites.austinlistingphotos.com sites.austinlistingphotos.com
sites.bluebruinphotography.com sites.bluebruinphotography.com
sites.changeovermedia.com sites.changeovermedia.com
sites.discoveraerial.com sites.discoveraerial.com
sites.elevatedphotos.ca sites.elevatedphotos.ca
sites.firelightimages.com sites.firelightimages.com
sites.flywithsas.com sites.flywithsas.com
sites.fullbarsmedia.com sites.fullbarsmedia.com
sites.gestaltgroup.com sites.gestaltgroup.com
sites.helicopix.com sites.helicopix.com
sites.highfivemediapro.com sites.highfivemediapro.com
sites.homelaunch.ca sites.homelaunch.ca
sites.jpmrealestatephotography.com sites.jpmrealestatephotography.com
sites.lunghistudio.com sites.lunghistudio.com
sites.matthewjamesphoto.ca sites.matthewjamesphoto.ca
sites.odyssey3d.ca sites.odyssey3d.ca
sites.realtronaccelerate.ca sites.realtronaccelerate.ca
sites.relahqdemo.com sites.relahqdemo.com
sites.ruummedia.com sites.ruummedia.com
sites.siliconvalleyphotos.com sites.siliconvalleyphotos.com
sites.sjvirtualtours.ca sites.sjvirtualtours.ca
sites.taftpix.com sites.taftpix.com
sites.taylorallancreative.com sites.taylorallancreative.com
sites.tracycolburn.com sites.tracycolburn.com
sites.uniquemediadesign.com sites.uniquemediadesign.com
sites.wtcreative.com sites.wtcreative.com
104mirasolct.com 104mirasolct.com
1142nvenetiandr.com 1142nvenetiandr.com
123iconstreet.com 123iconstreet.com
145robbyln.com 145robbyln.com
stonewellcourt.com stonewellcourt.com
theoutpostestate.com theoutpostestate.com
tour.api360.ca tour.api360.ca
tour.castlerealestatemarketing.com tour.castlerealestatemarketing.com
tours.benaccinelli.com tours.benaccinelli.com
tours.curb360.com tours.curb360.com
tours.vogelcreative.ca tours.vogelcreative.ca
veeshome.com veeshome.com
casadirame.com casadirame.com
brubeckhouse.com brubeckhouse.com
casaonpennell.com casaonpennell.com
my.aw360.me my.aw360.me
client.captivateproductions.org client.captivateproductions.org
designerhomestyles.com designerhomestyles.com
glass7thfloor.com glass7thfloor.com
harecreekterrace.com harecreekterrace.com
historiccromwellestate.com historiccromwellestate.com
hometour.me hometour.me
innerrichmondduplex.com innerrichmondduplex.com
liamlatin.com liamlatin.com
lincolnparklawnlust.com lincolnparklawnlust.com
listings.elevatedlistingstx.com listings.elevatedlistingstx.com
listings.focus-rep.com listings.focus-rep.com
listings.ground2airmedia.com listings.ground2airmedia.com
listings.mattpiercephoto.com listings.mattpiercephoto.com
listings.nextdoorphotos.com listings.nextdoorphotos.com
listings.photoreal.ca listings.photoreal.ca
listings.pixerpros.com listings.pixerpros.com
listings.relawldemo.com listings.relawldemo.com
listings.sitesforproperties.com listings.sitesforproperties.com
login.dynamictours.ca login.dynamictours.ca
login.focus-rep.com login.focus-rep.com
login.goosemediagroup.com login.goosemediagroup.com
login.hrantmedia.com login.hrantmedia.com
login.joshmeyerfilms.com login.joshmeyerfilms.com
login.skyrealtymedia.com login.skyrealtymedia.com
myrevedio.revedio.com myrevedio.revedio.com
palmiahomeforsale.com palmiahomeforsale.com
photos.laidlawphotography.com photos.laidlawphotography.com
portal.aremacphotography.com portal.aremacphotography.com
properties.lalush.com properties.lalush.com
ranchesatsentinelpeaktract3.com ranchesatsentinelpeaktract3.com
ritzcarltonvilla810.com ritzcarltonvilla810.com
aresortwithinaresort.com aresortwithinaresort.com
castrocondo.com castrocondo.com
agent.photographervince.com agent.photographervince.com
sites.artesiantitle.com sites.artesiantitle.com
sites.capturereality.io sites.capturereality.io
sites.crossroadsrealtynj.com sites.crossroadsrealtynj.com
sites.dreamhomeimages.com sites.dreamhomeimages.com
sites.elevatovisuals.com sites.elevatovisuals.com
sites.fullframecreativeagency.com sites.fullframecreativeagency.com
sites.genesisvue.com sites.genesisvue.com
sites.happyhousegta.com sites.happyhousegta.com
sites.jdmontero.com sites.jdmontero.com
sites.jmphilms.com sites.jmphilms.com
sites.kianikanstudio.ca sites.kianikanstudio.ca
sites.liftecmedia.com sites.liftecmedia.com
sites.listvt.com sites.listvt.com
sites.lounny.com sites.lounny.com
sites.mshaltout-realphotography.com sites.mshaltout-realphotography.com
sites.realtoursswfl.com sites.realtoursswfl.com
sites.reel2realestates.com sites.reel2realestates.com
sites.richmountcreative.com sites.richmountcreative.com
sites.royaltystudios.co sites.royaltystudios.co
sites.shutterlist.com sites.shutterlist.com
sites.slevinhurtado.com sites.slevinhurtado.com
sites.snapairphoto.com sites.snapairphoto.com
sites.southbaypics.com sites.southbaypics.com
sites.virtualview360.com sites.virtualview360.com
sites.walters.photography sites.walters.photography
sites.willventuresphoto.com sites.willventuresphoto.com
skye30a.com skye30a.com
1077rankin.com 1077rankin.com
13908hutchinsonplace.com 13908hutchinsonplace.com
150orleans510.com 150orleans510.com
stonecrestlaketahoe.com stonecrestlaketahoe.com
agent.verticalmediatx.com agent.verticalmediatx.com
surfclub410.com surfclub410.com
thehomeonvashon.com thehomeonvashon.com
themusehouse.com themusehouse.com
theoneinseattle.com theoneinseattle.com
tour.chadjonesphoto.com tour.chadjonesphoto.com
tour.digenovamedia.ca tour.digenovamedia.ca
tour.shutterhouse.ca tour.shutterhouse.ca
virtualtours.augmentum.ca virtualtours.augmentum.ca
brussels-st.com brussels-st.com
realestate.28photos.com realestate.28photos.com
my.topdownphotos.com my.topdownphotos.com
client.784design.com client.784design.com
client.benson-productions.com client.benson-productions.com
clientportal.redheiferproductions.com clientportal.redheiferproductions.com
clients.coastalhometours.com clients.coastalhometours.com
clients.coastalrealestatemedia.com clients.coastalrealestatemedia.com
glass9thfloor.com glass9thfloor.com
grandsummitranch.com grandsummitranch.com
homes.teamcirca.com homes.teamcirca.com
imperialhousephb.com imperialhousephb.com
remaxadvance.spectrumrealestatephotography.com remaxadvance.spectrumrealestatephotography.com
acreagehomeinredmond.com acreagehomeinredmond.com
seasidesandsinnmotel.com seasidesandsinnmotel.com
site.aimagery.com site.aimagery.com
sites.aeriousplus.com sites.aeriousplus.com
sites.brownbear-productions.com sites.brownbear-productions.com
sites.calrealestatemedia.com sites.calrealestatemedia.com
sites.curbviews.com sites.curbviews.com
sites.davewarren.net sites.davewarren.net
sites.digitalhometours.ca sites.digitalhometours.ca
sites.discovervirtual360.com sites.discovervirtual360.com
sites.dronehomemedia.com sites.dronehomemedia.com
sites.dustinclyde.com sites.dustinclyde.com
sites.housepics4u.ca sites.housepics4u.ca
sites.ictimaging.com sites.ictimaging.com
sites.inhabitphotography.com sites.inhabitphotography.com
sites.intextphotography.com sites.intextphotography.com
sites.itsrealestatepropertyservices.com sites.itsrealestatepropertyservices.com
sites.keesnap.com sites.keesnap.com
sites.megmediagroup.com sites.megmediagroup.com
sites.nausetmedia.com sites.nausetmedia.com
sites.njpropertypix.com sites.njpropertypix.com
sites.ospreymediaalliance.com sites.ospreymediaalliance.com
sites.pantheraaerial.com sites.pantheraaerial.com
sites.pdxdan.com sites.pdxdan.com
sites.porticomedia.net sites.porticomedia.net
sites.primeremedia.net sites.primeremedia.net
sites.radiantphotovideo.com sites.radiantphotovideo.com
sites.refleximaging.com sites.refleximaging.com
sites.seattleprophotography.com sites.seattleprophotography.com
sites.sfvt.us sites.sfvt.us
sites.shadowpointmedia.com sites.shadowpointmedia.com
sites.showingaustin.com sites.showingaustin.com
sites.staceyhennessy.com sites.staceyhennessy.com
sites.trifectamediasd.com sites.trifectamediasd.com
sites.virtourmedia.com sites.virtourmedia.com
sites.virtualviewtours.com sites.virtualviewtours.com
sites.vmdpros.com sites.vmdpros.com
sites.youngrealtymedia.com sites.youngrealtymedia.com
avegbythesea.com avegbythesea.com
10021686west13avenue.com 10021686west13avenue.com
103fairviewchurch.com 103fairviewchurch.com
106-bixby-hill.com 106-bixby-hill.com
129turnberryway.com 129turnberryway.com
12jacquelineroadunitc.com 12jacquelineroadunitc.com
1507mefferdave.com 1507mefferdave.com
bcpoverlook.com bcpoverlook.com
tour.amazinglistingphotos.com tour.amazinglistingphotos.com
tour.virtualrevolutionllc.com tour.virtualrevolutionllc.com
tours.zipp3d.com tours.zipp3d.com
bigtamview.com bigtamview.com
vannnoord.com vannnoord.com
virtualtours.luxoriginal.com virtualtours.luxoriginal.com
vtours.toddsfotos.com vtours.toddsfotos.com
booking.igm-realestate.com booking.igm-realestate.com
websites.arborvisualmedia.com websites.arborvisualmedia.com
buybuchanen.com buybuchanen.com
canariasdoral4439nw81ave.com canariasdoral4439nw81ave.com
s.victoriarealestatemarketing.tv s.victoriarealestatemarketing.tv
client.fullframehometours.com client.fullframehometours.com
client.huscp.com client.huscp.com
client.seancarrie.com client.seancarrie.com
clients.moorestudios.com clients.moorestudios.com
goldcanyonazland.com goldcanyonazland.com
grandlakevilla.com grandlakevilla.com
greenfielddr.com greenfielddr.com
home.venturesir.com home.venturesir.com
homes.dallaspro.com homes.dallaspro.com
hostedby.aftertecai.com hostedby.aftertecai.com
imperialhousepha.com imperialhousepha.com
lakeforestparkmidcenturygem.com lakeforestparkmidcenturygem.com
letitacrest.com letitacrest.com
listedhq.mhv.co listedhq.mhv.co
listing.im3rdmedia.com listing.im3rdmedia.com
listing.invznmedia.com listing.invznmedia.com
listing.pics listing.pics
listing4.com listing4.com
listings.alleganymedia.com listings.alleganymedia.com
listings.allieweaverinteriors.com listings.allieweaverinteriors.com
listings.demophotog.com listings.demophotog.com
listings.denpg.com listings.denpg.com
listings.dfwvt.com listings.dfwvt.com
listings.framexstudio.com listings.framexstudio.com
listings.gregsilvaphotography.com listings.gregsilvaphotography.com
listings.paidtogether.com listings.paidtogether.com
listings.revolrealestate.com listings.revolrealestate.com
listings.splicerealty.com listings.splicerealty.com
login.atozmedia.ca login.atozmedia.ca
login.jfarrismedia.com login.jfarrismedia.com
login.swetnammedia.com login.swetnammedia.com
lux.russlyon.com lux.russlyon.com
lwdreamhome.com lwdreamhome.com
media.propermeasure.com media.propermeasure.com
movingyouintherightdirection.com movingyouintherightdirection.com
myspaceport.orion3d.studio myspaceport.orion3d.studio
nurmiisles.com nurmiisles.com
ricoretreat.com ricoretreat.com
plantationpoimtsouth.com plantationpoimtsouth.com
portal.johnruzphoto.com portal.johnruzphoto.com
portal.local-shot.com portal.local-shot.com
properties.ryanhalseyphotography.com properties.ryanhalseyphotography.com
property.brookfieldphotographer.com property.brookfieldphotographer.com
relahq.com relahq.com
condoinclarksville.com condoinclarksville.com
cousteaulane.com cousteaulane.com
request.thedowntowncreative.com request.thedowntowncreative.com
sites.3eyemedia.com sites.3eyemedia.com
sites.5dgmedia.com sites.5dgmedia.com
sites.acreagency.com sites.acreagency.com
sites.architaraphoto.com sites.architaraphoto.com
sites.beesknees-photography.com sites.beesknees-photography.com
sites.cathykoop.ca sites.cathykoop.ca
sites.csrarealestatephoto.com sites.csrarealestatephoto.com
sites.domusvisions.com sites.domusvisions.com
sites.dynamictours.ca sites.dynamictours.ca
sites.eastbayrealestatevideos.com sites.eastbayrealestatevideos.com
sites.elevotix.com sites.elevotix.com
sites.explorify3d.com sites.explorify3d.com
sites.flylisted.com sites.flylisted.com
sites.hangtime27.com sites.hangtime27.com
sites.harmonps.com sites.harmonps.com
sites.home-views.com sites.home-views.com
sites.homejab.com sites.homejab.com
sites.i3dtours.com sites.i3dtours.com
sites.limestmedia.com sites.limestmedia.com
sites.listing-standard.com sites.listing-standard.com
sites.mccourtneyphotographics.com sites.mccourtneyphotographics.com
sites.oneshotprods.com sites.oneshotprods.com
sites.pdxrealestatetours.com sites.pdxrealestatetours.com
sites.precipitousimaging.com sites.precipitousimaging.com
sites.quickcloselistings.com sites.quickcloselistings.com
sites.realestatemarketing-services.com sites.realestatemarketing-services.com
sites.realpatience.com sites.realpatience.com
sites.scatterscape.com sites.scatterscape.com
sites.skyshotstudios.com sites.skyshotstudios.com
sites.solpix.co sites.solpix.co
sites.sparksmediagroup.com sites.sparksmediagroup.com
sites.tcvtours3d.com sites.tcvtours3d.com
sites.trueonegroup.com sites.trueonegroup.com
sites.trueperceptionimages.com sites.trueperceptionimages.com
sites.vantagemediaproductions.com sites.vantagemediaproductions.com
sites.visionnj.com sites.visionnj.com
assemblyliving.com assemblyliving.com
10979chalonroad.net 10979chalonroad.net
1234address.com 1234address.com
templates.lunghimediagroup.com templates.lunghimediagroup.com
tour.higginbothammedia.com tour.higginbothammedia.com
tour.seacoastrephotography.com tour.seacoastrephotography.com
tours.amazingphotovideo.com tours.amazingphotovideo.com
tours.blueoceanmiami.com tours.blueoceanmiami.com
tours.caldecott.com tours.caldecott.com
tours.dronetoursllc.com tours.dronetoursllc.com
tours.justaskjask.com tours.justaskjask.com
tours.newvisionstudio.com tours.newvisionstudio.com
tours.photoconnor.com tours.photoconnor.com
tours.srq360media.com tours.srq360media.com
tours.vrsquadinc.com tours.vrsquadinc.com
user.vividvm.com user.vividvm.com
virtualtour.c21colonial.ca virtualtour.c21colonial.ca
westgissingroad.com westgissingroad.com
u.listvt.com u.listvt.com
client.goproptech.com client.goproptech.com
clients.cre8r.agency clients.cre8r.agency
clients.jackvatcherphotography.com clients.jackvatcherphotography.com
featured.islandsothebysrealty.com featured.islandsothebysrealty.com
homes.btwimages.com homes.btwimages.com
homes.ejp.photo homes.ejp.photo
homes.motioncitymedia.com homes.motioncitymedia.com
irownwoodcrossingqc.com irownwoodcrossingqc.com
kensingtontic.com kensingtontic.com
listedhq.com listedhq.com
listing.growthehive.com listing.growthehive.com
listing.hiverealestatemedia.com listing.hiverealestatemedia.com
listing.morrisonteam.com listing.morrisonteam.com
listing.trevisuality.com listing.trevisuality.com
listings.bokomedia.com listings.bokomedia.com
listings.homevideorealestate.com listings.homevideorealestate.com
listings.picpros.ca listings.picpros.ca
listings.zuwerksphotography.com listings.zuwerksphotography.com
listvt.com listvt.com
login.aimmedia.group login.aimmedia.group
login.treefort-media.com login.treefort-media.com
lwopenhouse.com lwopenhouse.com
mysite.the3rdeye.ca mysite.the3rdeye.ca
oldesouthva.com oldesouthva.com
properties.scherbamedia.com properties.scherbamedia.com
CLIENT.CREPHOTOS.COM
IP History

Click the IP addresses to see over domains using them.