Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

SITES.HOMEJAB.COM

SITES.HOMEJAB.COM
Shared Attributes
Domain
fdimedia.com listing.fdimedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 89 days
otbxair.com listing.otbxair.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 208 days
aerialcanvas.com listings.aerialcanvas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
axtonandliv.com listings.axtonandliv.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 177 days
docprops.com listings.docprops.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 184 days
realtyexecutivesbw.com listings.realtyexecutivesbw.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 158 days
snapsharks.com listings.snapsharks.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 219 days
thergbstudios.com listings.thergbstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 221 days
vastmediaspace.com listings.vastmediaspace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 223 days
westrobin.com listings.westrobin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 224 days
aperturemedia.io live.aperturemedia.io
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
kuperrealty.com live.kuperrealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
luxehomestyles.com luxehomestyles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 186 days
lwvhome.com lwvhome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 21 days
madrone118.com madrone118.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 108 days
cincyvisuals.com media.cincyvisuals.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
openhouse360.com media.openhouse360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 208 days
remco.solutions media.remco.solutions
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 214 days
estatephotos.la mylisting.estatephotos.la
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 89 days
orion3dstudios.com myspaceport.orion3dstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 208 days
ranchobuenavidatexas.com ranchobuenavidatexas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 58 days
palmiahomesforsale.com palmiahomesforsale.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 123 days
lresmarketing.com photos.lresmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 223 days
scrug.gs portfolio.scrug.gs
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 216 days
aspectvisuals.co properties.aspectvisuals.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 50 days
lumifulmedia.com properties.lumifulmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Sep 2023 22 days
shftgroup.ca properties.shftgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 217 days
spectrumrealestatephotography.com properties.spectrumrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 163 days
jdpworks.com remedia.jdpworks.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 196 days
rent1313sealway.com rent1313sealway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 174 days
scenicdriveestate.com scenicdriveestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Mar 2024 109 days
seasidepearlfarmgatewinery.info seasidepearlfarmgatewinery.info
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 172 days
adioimages.com sites.adioimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
allmediatours.com sites.allmediatours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
ardentmediagroup.ca sites.ardentmediagroup.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
austinlistingphotos.com sites.austinlistingphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 81 days
bluebruinphotography.com sites.bluebruinphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Oct 2023 45 days
changeovermedia.com sites.changeovermedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
craigsauer3d.com sites.craigsauer3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
discoveraerial.com sites.discoveraerial.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 184 days
elevatedphotos.ca sites.elevatedphotos.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 88 days
firelightimages.com sites.firelightimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 189 days
flywithsas.com sites.flywithsas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 189 days
fullbarsmedia.com sites.fullbarsmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 190 days
gestaltgroup.com sites.gestaltgroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Mar 2024 99 days
helicopix.com sites.helicopix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 193 days
highfivemediapro.com sites.highfivemediapro.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 193 days
homelaunch.ca sites.homelaunch.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 194 days
jpmrealestatephotography.com sites.jpmrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 197 days
lunghistudio.com sites.lunghistudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 225 days
matthewjamesphoto.ca sites.matthewjamesphoto.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 202 days
odyssey3d.ca sites.odyssey3d.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 207 days
realtronaccelerate.ca sites.realtronaccelerate.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 213 days
relahqdemo.com sites.relahqdemo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 213 days
ruummedia.com sites.ruummedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 215 days
siliconvalleyphotos.com sites.siliconvalleyphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 218 days
sjvirtualtours.ca sites.sjvirtualtours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 218 days
taftpix.com sites.taftpix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 164 days
taylorallancreative.com sites.taylorallancreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 220 days
tracycolburn.com sites.tracycolburn.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Oct 2023 37 days
uniquemediadesign.com sites.uniquemediadesign.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
wtcreative.com sites.wtcreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 225 days
104mirasolct.com 104mirasolct.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Sep 2023 One Off
1142nvenetiandr.com 1142nvenetiandr.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 One Off
123iconstreet.com 123iconstreet.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
145robbyln.com 145robbyln.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 53 days
stonewellcourt.com stonewellcourt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 56 days
theoutpostestate.com theoutpostestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
api360.ca tour.api360.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
benaccinelli.com tours.benaccinelli.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
curb360.com tours.curb360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 85 days
vogelcreative.ca tours.vogelcreative.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 223 days
veeshome.com veeshome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 223 days
casadirame.com casadirame.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 208 days
brubeckhouse.com brubeckhouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 180 days
casaonpennell.com casaonpennell.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Apr 2024 144 days
aw360.me my.aw360.me
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 177 days
captivateproductions.org client.captivateproductions.org
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Sep 2023 6 days
designerhomestyles.com designerhomestyles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Apr 2024 137 days
glass7thfloor.com glass7thfloor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 109 days
harecreekterrace.com harecreekterrace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 61 days
historiccromwellestate.com historiccromwellestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Sep 2023 One Off
hometour.me hometour.me
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 92 days
innerrichmondduplex.com innerrichmondduplex.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 24 days
liamlatin.com liamlatin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 188 days
lincolnparklawnlust.com lincolnparklawnlust.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 130 days
elevatedlistingstx.com listings.elevatedlistingstx.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Jan 2024 134 days
focus-rep.com listings.focus-rep.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Oct 2023 53 days
ground2airmedia.com listings.ground2airmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Jan 2024 139 days
mattpiercephoto.com listings.mattpiercephoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Dec 2023 99 days
nextdoorphotos.com listings.nextdoorphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Jan 2024 153 days
photoreal.ca listings.photoreal.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 210 days
relawldemo.com listings.relawldemo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 213 days
dynamictours.ca login.dynamictours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2024 Feb 2024 52 days
goosemediagroup.com login.goosemediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 191 days
revedio.com myrevedio.revedio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 214 days
palmiahomeforsale.com palmiahomeforsale.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 18 days
laidlawphotography.com photos.laidlawphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Dec 2023 96 days
aremacphotography.com portal.aremacphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
lalush.com properties.lalush.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Dec 2023 96 days
ranchesatsentinelpeaktract3.com ranchesatsentinelpeaktract3.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 54 days
ritzcarltonvilla810.com ritzcarltonvilla810.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Mar 2024 108 days
castrocondo.com castrocondo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 110 days
photographervince.com agent.photographervince.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Nov 2023 One Off
artesiantitle.com sites.artesiantitle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Oct 2023 43 days
capturereality.io sites.capturereality.io
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
coremarketingconcepts.com sites.coremarketingconcepts.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
dreamhomeimages.com sites.dreamhomeimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 185 days
elevatovisuals.com sites.elevatovisuals.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 88 days
fullframecreativeagency.com sites.fullframecreativeagency.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
genesisvue.com sites.genesisvue.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 190 days
happyhousegta.com sites.happyhousegta.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 92 days
jdmontero.com sites.jdmontero.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Sep 2023 19 days
jmphilms.com sites.jmphilms.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 197 days
kianikanstudio.ca sites.kianikanstudio.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 139 days
liftecmedia.com sites.liftecmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 208 days
listvt.com sites.listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 214 days
lounny.com sites.lounny.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 221 days
realtoursswfl.com sites.realtoursswfl.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 213 days
reel2realestates.com sites.reel2realestates.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Sep 2023 30 days
richmountcreative.com sites.richmountcreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 214 days
royaltystudios.co sites.royaltystudios.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 215 days
shutterlist.com sites.shutterlist.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 218 days
slevinhurtado.com sites.slevinhurtado.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Apr 2024 148 days
snapairphoto.com sites.snapairphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 219 days
southbaypics.com sites.southbaypics.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 219 days
virtualview360.com sites.virtualview360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 223 days
walters.photography sites.walters.photography
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 224 days
willventuresphoto.com sites.willventuresphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 224 days
skye30a.com skye30a.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Apr 2024 156 days
1077rankin.com 1077rankin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 164 days
13908hutchinsonplace.com 13908hutchinsonplace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Dec 2023 One Off
150orleans510.com 150orleans510.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Sep 2023 One Off
stonecrestlaketahoe.com stonecrestlaketahoe.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
verticalmediatx.com agent.verticalmediatx.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 131 days
surfclub410.com surfclub410.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 6 days
thehomeonvashon.com thehomeonvashon.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 165 days
themusehouse.com themusehouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 165 days
theoneinseattle.com theoneinseattle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 126 days
chadjonesphoto.com tour.chadjonesphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 181 days
digenovamedia.ca tour.digenovamedia.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Jan 2024 132 days
shutterhouse.ca tour.shutterhouse.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 218 days
augmentum.ca virtualtours.augmentum.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 223 days
brussels-st.com brussels-st.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Sep 2023 17 days
28photos.com realestate.28photos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
topdownphotos.com my.topdownphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 55 days
784design.com client.784design.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
crephotos.com client.crephotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
redheiferproductions.com clientportal.redheiferproductions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 128 days
coastalrealestatemedia.com clients.coastalrealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
glass9thfloor.com glass9thfloor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 33 days
grandsummitranch.com grandsummitranch.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
teamcirca.com homes.teamcirca.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 220 days
imperialhousephb.com imperialhousephb.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 30 days
spectrumrealestatephotography.com remaxadvance.spectrumrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 163 days
acreagehomeinredmond.com acreagehomeinredmond.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Dec 2023 111 days
seasidesandsinnmotel.com seasidesandsinnmotel.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 172 days
aimagery.com site.aimagery.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
aeriousplus.com sites.aeriousplus.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
calrealestatemedia.com sites.calrealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
craigbernardi.com sites.craigbernardi.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
curbviews.com sites.curbviews.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 182 days
davewarren.net sites.davewarren.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Sep 2023 8 days
digitalhometours.ca sites.digitalhometours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 135 days
discovervirtual360.com sites.discovervirtual360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 184 days
dronehomemedia.com sites.dronehomemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 185 days
dustinclyde.com sites.dustinclyde.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 185 days
housepics4u.ca sites.housepics4u.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 194 days
ictimaging.com sites.ictimaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 209 days
inhabitphotography.com sites.inhabitphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 195 days
intextphotography.com sites.intextphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 195 days
itsrealestatepropertyservices.com sites.itsrealestatepropertyservices.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Jan 2024 143 days
keesnap.com sites.keesnap.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 39 days
megmediagroup.com sites.megmediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 203 days
nausetmedia.com sites.nausetmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 206 days
njpropertypix.com sites.njpropertypix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 37 days
pantheraaerial.com sites.pantheraaerial.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 210 days
pdxdan.com sites.pdxdan.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Jan 2024 156 days
porticomedia.net sites.porticomedia.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 211 days
primeremedia.net sites.primeremedia.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 211 days
radiantphotovideo.com sites.radiantphotovideo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 213 days
refleximaging.com sites.refleximaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 213 days
seattleprophotography.com sites.seattleprophotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 216 days
shadowpointmedia.com sites.shadowpointmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 217 days
showingaustin.com sites.showingaustin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 161 days
staceyhennessy.com sites.staceyhennessy.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 219 days
trifectamediasd.com sites.trifectamediasd.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 73 days
virtourmedia.com sites.virtourmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 223 days
vmdpros.com sites.vmdpros.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 One Off
youngrealtymedia.com sites.youngrealtymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 107 days
avegbythesea.com avegbythesea.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 182 days
10021686west13avenue.com 10021686west13avenue.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 33 days
103fairviewchurch.com 103fairviewchurch.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 54 days
106-bixby-hill.com 106-bixby-hill.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 62 days
129turnberryway.com 129turnberryway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 33 days
12jacquelineroadunitc.com 12jacquelineroadunitc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Dec 2023 112 days
1507mefferdave.com 1507mefferdave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 70 days
amazinglistingphotos.com tour.amazinglistingphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
virtualrevolutionllc.com tour.virtualrevolutionllc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 223 days
zipp3d.com tours.zipp3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 225 days
bigtamview.com bigtamview.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 181 days
vannnoord.com vannnoord.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 188 days
luxoriginal.com virtualtours.luxoriginal.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Oct 2023 61 days
toddsfotos.com vtours.toddsfotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 222 days
igm-realestate.com booking.igm-realestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Mar 2024 101 days
arborvisualmedia.com websites.arborvisualmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
buybuchanen.com buybuchanen.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 111 days
canariasdoral4439nw81ave.com canariasdoral4439nw81ave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 65 days
victoriarealestatemarketing.tv s.victoriarealestatemarketing.tv
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 223 days
fullframehometours.com client.fullframehometours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 190 days
huscp.com client.huscp.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 194 days
seancarrie.com client.seancarrie.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 216 days
moorestudios.com clients.moorestudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 141 days
goldcanyonazland.com goldcanyonazland.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 24 days
grandlakevilla.com grandlakevilla.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 196 days
greenfielddr.com greenfielddr.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 196 days
venturesir.com home.venturesir.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 223 days
dallaspro.com homes.dallaspro.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
aftertecai.com hostedby.aftertecai.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
imperialhousepha.com imperialhousepha.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 30 days
lakeforestparkmidcenturygem.com lakeforestparkmidcenturygem.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 130 days
letitacrest.com letitacrest.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 87 days
mhv.co listedhq.mhv.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 203 days
im3rdmedia.com listing.im3rdmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 194 days
invznmedia.com listing.invznmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 195 days
listing4.com listing4.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 213 days
alleganymedia.com listings.alleganymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 80 days
allieweaverinteriors.com listings.allieweaverinteriors.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 80 days
demophotog.com listings.demophotog.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
denpg.com listings.denpg.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 183 days
dfwvt.com listings.dfwvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 184 days
framexstudio.com listings.framexstudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 189 days
paidtogether.com listings.paidtogether.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 209 days
revolrealestate.com listings.revolrealestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 214 days
splicerealty.com listings.splicerealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 One Off
jfarrismedia.com login.jfarrismedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2024 Mar 2024 53 days
russlyon.com lux.russlyon.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 77 days
lwdreamhome.com lwdreamhome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 106 days
propermeasure.com media.propermeasure.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 212 days
movingyouintherightdirection.com movingyouintherightdirection.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 183 days
orion3d.studio myspaceport.orion3d.studio
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 208 days
nurmiisles.com nurmiisles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 199 days
ricoretreat.com ricoretreat.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 67 days
plantationpoimtsouth.com plantationpoimtsouth.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 162 days
johnruzphoto.com portal.johnruzphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Mar 2024 103 days
local-shot.com portal.local-shot.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 218 days
brookfieldphotographer.com property.brookfieldphotographer.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
relahq.com relahq.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
thedowntowncreative.com request.thedowntowncreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 221 days
3eyemedia.com sites.3eyemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
5dgmedia.com sites.5dgmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Dec 2023 119 days
acreagency.com sites.acreagency.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 78 days
architaraphoto.com sites.architaraphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
beesknees-photography.com sites.beesknees-photography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 101 days
cathykoop.ca sites.cathykoop.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 46 days
csrarealestatephoto.com sites.csrarealestatephoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Sep 2023 8 days
dynamictours.ca sites.dynamictours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Sep 2023 11 days
eastbayrealestatevideos.com sites.eastbayrealestatevideos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 185 days
elevotix.com sites.elevotix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Feb 2024 98 days
explorify3d.com sites.explorify3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 187 days
flylisted.com sites.flylisted.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 189 days
hangtime27.com sites.hangtime27.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 192 days
harmonps.com sites.harmonps.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 193 days
home-views.com sites.home-views.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 194 days
i3dtours.com sites.i3dtours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 194 days
limestmedia.com sites.limestmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Jan 2024 147 days
listing-standard.com sites.listing-standard.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 214 days
mccourtneyphotographics.com sites.mccourtneyphotographics.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 203 days
oneshotprods.com sites.oneshotprods.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 208 days
pdxrealestatetours.com sites.pdxrealestatetours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 210 days
precipitousimaging.com sites.precipitousimaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Mar 2024 107 days
quickcloselistings.com sites.quickcloselistings.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 212 days
realpatience.com sites.realpatience.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 158 days
scatterscape.com sites.scatterscape.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 216 days
skyshotstudios.com sites.skyshotstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 218 days
solpix.co sites.solpix.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
sparksmediagroup.com sites.sparksmediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 219 days
tcvtours3d.com sites.tcvtours3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 220 days
trueonegroup.com sites.trueonegroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 222 days
trueperceptionimages.com sites.trueperceptionimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 222 days
vantagemediaproductions.com sites.vantagemediaproductions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 One Off
visionnj.com sites.visionnj.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 169 days
assemblyliving.com assemblyliving.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
10979chalonroad.net 10979chalonroad.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 218 days
1234address.com 1234address.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Apr 2024 218 days
lunghimediagroup.com templates.lunghimediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 225 days
seacoastrephotography.com tour.seacoastrephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 216 days
amazingphotovideo.com tours.amazingphotovideo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 80 days
blueoceanmiami.com tours.blueoceanmiami.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
dronetoursllc.com tours.dronetoursllc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 185 days
justaskjask.com tours.justaskjask.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 197 days
newvisionstudio.com tours.newvisionstudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
photoconnor.com tours.photoconnor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 210 days
srq360media.com tours.srq360media.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 219 days
vrsquadinc.com tours.vrsquadinc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 224 days
vividvm.com user.vividvm.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 169 days
c21colonial.ca virtualtour.c21colonial.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Jan 2024 128 days
westgissingroad.com westgissingroad.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 187 days
listvt.com u.listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 214 days
cre8r.agency clients.cre8r.agency
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 44 days
jackvatcherphotography.com clients.jackvatcherphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Jan 2024 143 days
islandsothebysrealty.com featured.islandsothebysrealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
btwimages.com homes.btwimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
ejp.photo homes.ejp.photo
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 186 days
motioncitymedia.com homes.motioncitymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
irownwoodcrossingqc.com irownwoodcrossingqc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Dec 2023 One Off
kensingtontic.com kensingtontic.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
listedhq.com listedhq.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 213 days
hiverealestatemedia.com listing.hiverealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 193 days
morrisonteam.com listing.morrisonteam.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 205 days
trevisuality.com listing.trevisuality.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 222 days
bokomedia.com listings.bokomedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Oct 2023 45 days
homevideorealestate.com listings.homevideorealestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Nov 2023 92 days
picpros.ca listings.picpros.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 211 days
zuwerksphotography.com listings.zuwerksphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 225 days
listvt.com listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 214 days
aimmedia.group login.aimmedia.group
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
treefort-media.com login.treefort-media.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 222 days
lwopenhouse.com lwopenhouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024 226 days
oldesouthva.com oldesouthva.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 19 days
scherbamedia.com properties.scherbamedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Mar 2024 216 days
SITES.HOMEJAB.COM
Non IP Attributes
Attribute First Last
IC IC-ZN9P6ZWJ Aug 2023 Apr 2024
SITES.HOMEJAB.COM
Overlap Attribute Domains
listing.fdimedia.com listing.fdimedia.com
listing.otbxair.com listing.otbxair.com
listings.aerialcanvas.com listings.aerialcanvas.com
listings.axtonandliv.com listings.axtonandliv.com
listings.docprops.com listings.docprops.com
listings.realtyexecutivesbw.com listings.realtyexecutivesbw.com
listings.snapsharks.com listings.snapsharks.com
listings.thergbstudios.com listings.thergbstudios.com
listings.vastmediaspace.com listings.vastmediaspace.com
listings.westrobin.com listings.westrobin.com
live.aperturemedia.io live.aperturemedia.io
live.kuperrealty.com live.kuperrealty.com
luxehomestyles.com luxehomestyles.com
lwvhome.com lwvhome.com
madrone118.com madrone118.com
media.cincyvisuals.com media.cincyvisuals.com
media.openhouse360.com media.openhouse360.com
media.remco.solutions media.remco.solutions
mylisting.estatephotos.la mylisting.estatephotos.la
myspaceport.orion3dstudios.com myspaceport.orion3dstudios.com
ranchobuenavidatexas.com ranchobuenavidatexas.com
palmiahomesforsale.com palmiahomesforsale.com
photos.lresmarketing.com photos.lresmarketing.com
portfolio.scrug.gs portfolio.scrug.gs
properties.aspectvisuals.co properties.aspectvisuals.co
properties.lumifulmedia.com properties.lumifulmedia.com
properties.shftgroup.ca properties.shftgroup.ca
properties.spectrumrealestatephotography.com properties.spectrumrealestatephotography.com
remedia.jdpworks.com remedia.jdpworks.com
rent1313sealway.com rent1313sealway.com
scenicdriveestate.com scenicdriveestate.com
seasidepearlfarmgatewinery.info seasidepearlfarmgatewinery.info
sites.adioimages.com sites.adioimages.com
sites.allmediatours.com sites.allmediatours.com
sites.ardentmediagroup.ca sites.ardentmediagroup.ca
sites.austinlistingphotos.com sites.austinlistingphotos.com
sites.bluebruinphotography.com sites.bluebruinphotography.com
sites.changeovermedia.com sites.changeovermedia.com
sites.craigsauer3d.com sites.craigsauer3d.com
sites.discoveraerial.com sites.discoveraerial.com
sites.elevatedphotos.ca sites.elevatedphotos.ca
sites.firelightimages.com sites.firelightimages.com
sites.flywithsas.com sites.flywithsas.com
sites.fullbarsmedia.com sites.fullbarsmedia.com
sites.gestaltgroup.com sites.gestaltgroup.com
sites.helicopix.com sites.helicopix.com
sites.highfivemediapro.com sites.highfivemediapro.com
sites.homelaunch.ca sites.homelaunch.ca
sites.jpmrealestatephotography.com sites.jpmrealestatephotography.com
sites.lunghistudio.com sites.lunghistudio.com
sites.matthewjamesphoto.ca sites.matthewjamesphoto.ca
sites.odyssey3d.ca sites.odyssey3d.ca
sites.realtronaccelerate.ca sites.realtronaccelerate.ca
sites.relahqdemo.com sites.relahqdemo.com
sites.ruummedia.com sites.ruummedia.com
sites.siliconvalleyphotos.com sites.siliconvalleyphotos.com
sites.sjvirtualtours.ca sites.sjvirtualtours.ca
sites.taftpix.com sites.taftpix.com
sites.taylorallancreative.com sites.taylorallancreative.com
sites.tracycolburn.com sites.tracycolburn.com
sites.uniquemediadesign.com sites.uniquemediadesign.com
sites.wtcreative.com sites.wtcreative.com
104mirasolct.com 104mirasolct.com
1142nvenetiandr.com 1142nvenetiandr.com
123iconstreet.com 123iconstreet.com
145robbyln.com 145robbyln.com
stonewellcourt.com stonewellcourt.com
theoutpostestate.com theoutpostestate.com
tour.api360.ca tour.api360.ca
tours.benaccinelli.com tours.benaccinelli.com
tours.curb360.com tours.curb360.com
tours.vogelcreative.ca tours.vogelcreative.ca
veeshome.com veeshome.com
casadirame.com casadirame.com
brubeckhouse.com brubeckhouse.com
casaonpennell.com casaonpennell.com
my.aw360.me my.aw360.me
client.captivateproductions.org client.captivateproductions.org
designerhomestyles.com designerhomestyles.com
glass7thfloor.com glass7thfloor.com
harecreekterrace.com harecreekterrace.com
historiccromwellestate.com historiccromwellestate.com
hometour.me hometour.me
innerrichmondduplex.com innerrichmondduplex.com
liamlatin.com liamlatin.com
lincolnparklawnlust.com lincolnparklawnlust.com
listings.elevatedlistingstx.com listings.elevatedlistingstx.com
listings.focus-rep.com listings.focus-rep.com
listings.ground2airmedia.com listings.ground2airmedia.com
listings.mattpiercephoto.com listings.mattpiercephoto.com
listings.nextdoorphotos.com listings.nextdoorphotos.com
listings.photoreal.ca listings.photoreal.ca
listings.relawldemo.com listings.relawldemo.com
login.dynamictours.ca login.dynamictours.ca
login.goosemediagroup.com login.goosemediagroup.com
myrevedio.revedio.com myrevedio.revedio.com
palmiahomeforsale.com palmiahomeforsale.com
photos.laidlawphotography.com photos.laidlawphotography.com
portal.aremacphotography.com portal.aremacphotography.com
properties.lalush.com properties.lalush.com
ranchesatsentinelpeaktract3.com ranchesatsentinelpeaktract3.com
ritzcarltonvilla810.com ritzcarltonvilla810.com
castrocondo.com castrocondo.com
agent.photographervince.com agent.photographervince.com
sites.artesiantitle.com sites.artesiantitle.com
sites.capturereality.io sites.capturereality.io
sites.coremarketingconcepts.com sites.coremarketingconcepts.com
sites.dreamhomeimages.com sites.dreamhomeimages.com
sites.elevatovisuals.com sites.elevatovisuals.com
sites.fullframecreativeagency.com sites.fullframecreativeagency.com
sites.genesisvue.com sites.genesisvue.com
sites.happyhousegta.com sites.happyhousegta.com
sites.jdmontero.com sites.jdmontero.com
sites.jmphilms.com sites.jmphilms.com
sites.kianikanstudio.ca sites.kianikanstudio.ca
sites.liftecmedia.com sites.liftecmedia.com
sites.listvt.com sites.listvt.com
sites.lounny.com sites.lounny.com
sites.realtoursswfl.com sites.realtoursswfl.com
sites.reel2realestates.com sites.reel2realestates.com
sites.richmountcreative.com sites.richmountcreative.com
sites.royaltystudios.co sites.royaltystudios.co
sites.shutterlist.com sites.shutterlist.com
sites.slevinhurtado.com sites.slevinhurtado.com
sites.snapairphoto.com sites.snapairphoto.com
sites.southbaypics.com sites.southbaypics.com
sites.virtualview360.com sites.virtualview360.com
sites.walters.photography sites.walters.photography
sites.willventuresphoto.com sites.willventuresphoto.com
skye30a.com skye30a.com
1077rankin.com 1077rankin.com
13908hutchinsonplace.com 13908hutchinsonplace.com
150orleans510.com 150orleans510.com
stonecrestlaketahoe.com stonecrestlaketahoe.com
agent.verticalmediatx.com agent.verticalmediatx.com
surfclub410.com surfclub410.com
thehomeonvashon.com thehomeonvashon.com
themusehouse.com themusehouse.com
theoneinseattle.com theoneinseattle.com
tour.chadjonesphoto.com tour.chadjonesphoto.com
tour.digenovamedia.ca tour.digenovamedia.ca
tour.shutterhouse.ca tour.shutterhouse.ca
virtualtours.augmentum.ca virtualtours.augmentum.ca
brussels-st.com brussels-st.com
realestate.28photos.com realestate.28photos.com
my.topdownphotos.com my.topdownphotos.com
client.784design.com client.784design.com
client.crephotos.com client.crephotos.com
clientportal.redheiferproductions.com clientportal.redheiferproductions.com
clients.coastalrealestatemedia.com clients.coastalrealestatemedia.com
glass9thfloor.com glass9thfloor.com
grandsummitranch.com grandsummitranch.com
homes.teamcirca.com homes.teamcirca.com
imperialhousephb.com imperialhousephb.com
remaxadvance.spectrumrealestatephotography.com remaxadvance.spectrumrealestatephotography.com
acreagehomeinredmond.com acreagehomeinredmond.com
seasidesandsinnmotel.com seasidesandsinnmotel.com
site.aimagery.com site.aimagery.com
sites.aeriousplus.com sites.aeriousplus.com
sites.calrealestatemedia.com sites.calrealestatemedia.com
sites.craigbernardi.com sites.craigbernardi.com
sites.curbviews.com sites.curbviews.com
sites.davewarren.net sites.davewarren.net
sites.digitalhometours.ca sites.digitalhometours.ca
sites.discovervirtual360.com sites.discovervirtual360.com
sites.dronehomemedia.com sites.dronehomemedia.com
sites.dustinclyde.com sites.dustinclyde.com
sites.housepics4u.ca sites.housepics4u.ca
sites.ictimaging.com sites.ictimaging.com
sites.inhabitphotography.com sites.inhabitphotography.com
sites.intextphotography.com sites.intextphotography.com
sites.itsrealestatepropertyservices.com sites.itsrealestatepropertyservices.com
sites.keesnap.com sites.keesnap.com
sites.megmediagroup.com sites.megmediagroup.com
sites.nausetmedia.com sites.nausetmedia.com
sites.njpropertypix.com sites.njpropertypix.com
sites.pantheraaerial.com sites.pantheraaerial.com
sites.pdxdan.com sites.pdxdan.com
sites.porticomedia.net sites.porticomedia.net
sites.primeremedia.net sites.primeremedia.net
sites.radiantphotovideo.com sites.radiantphotovideo.com
sites.refleximaging.com sites.refleximaging.com
sites.seattleprophotography.com sites.seattleprophotography.com
sites.shadowpointmedia.com sites.shadowpointmedia.com
sites.showingaustin.com sites.showingaustin.com
sites.staceyhennessy.com sites.staceyhennessy.com
sites.trifectamediasd.com sites.trifectamediasd.com
sites.virtourmedia.com sites.virtourmedia.com
sites.vmdpros.com sites.vmdpros.com
sites.youngrealtymedia.com sites.youngrealtymedia.com
avegbythesea.com avegbythesea.com
10021686west13avenue.com 10021686west13avenue.com
103fairviewchurch.com 103fairviewchurch.com
106-bixby-hill.com 106-bixby-hill.com
129turnberryway.com 129turnberryway.com
12jacquelineroadunitc.com 12jacquelineroadunitc.com
1507mefferdave.com 1507mefferdave.com
tour.amazinglistingphotos.com tour.amazinglistingphotos.com
tour.virtualrevolutionllc.com tour.virtualrevolutionllc.com
tours.zipp3d.com tours.zipp3d.com
bigtamview.com bigtamview.com
vannnoord.com vannnoord.com
virtualtours.luxoriginal.com virtualtours.luxoriginal.com
vtours.toddsfotos.com vtours.toddsfotos.com
booking.igm-realestate.com booking.igm-realestate.com
websites.arborvisualmedia.com websites.arborvisualmedia.com
buybuchanen.com buybuchanen.com
canariasdoral4439nw81ave.com canariasdoral4439nw81ave.com
s.victoriarealestatemarketing.tv s.victoriarealestatemarketing.tv
client.fullframehometours.com client.fullframehometours.com
client.huscp.com client.huscp.com
client.seancarrie.com client.seancarrie.com
clients.moorestudios.com clients.moorestudios.com
goldcanyonazland.com goldcanyonazland.com
grandlakevilla.com grandlakevilla.com
greenfielddr.com greenfielddr.com
home.venturesir.com home.venturesir.com
homes.dallaspro.com homes.dallaspro.com
hostedby.aftertecai.com hostedby.aftertecai.com
imperialhousepha.com imperialhousepha.com
lakeforestparkmidcenturygem.com lakeforestparkmidcenturygem.com
letitacrest.com letitacrest.com
listedhq.mhv.co listedhq.mhv.co
listing.im3rdmedia.com listing.im3rdmedia.com
listing.invznmedia.com listing.invznmedia.com
listing4.com listing4.com
listings.alleganymedia.com listings.alleganymedia.com
listings.allieweaverinteriors.com listings.allieweaverinteriors.com
listings.demophotog.com listings.demophotog.com
listings.denpg.com listings.denpg.com
listings.dfwvt.com listings.dfwvt.com
listings.framexstudio.com listings.framexstudio.com
listings.paidtogether.com listings.paidtogether.com
listings.revolrealestate.com listings.revolrealestate.com
listings.splicerealty.com listings.splicerealty.com
login.jfarrismedia.com login.jfarrismedia.com
lux.russlyon.com lux.russlyon.com
lwdreamhome.com lwdreamhome.com
media.propermeasure.com media.propermeasure.com
movingyouintherightdirection.com movingyouintherightdirection.com
myspaceport.orion3d.studio myspaceport.orion3d.studio
nurmiisles.com nurmiisles.com
ricoretreat.com ricoretreat.com
plantationpoimtsouth.com plantationpoimtsouth.com
portal.johnruzphoto.com portal.johnruzphoto.com
portal.local-shot.com portal.local-shot.com
property.brookfieldphotographer.com property.brookfieldphotographer.com
relahq.com relahq.com
request.thedowntowncreative.com request.thedowntowncreative.com
sites.3eyemedia.com sites.3eyemedia.com
sites.5dgmedia.com sites.5dgmedia.com
sites.acreagency.com sites.acreagency.com
sites.architaraphoto.com sites.architaraphoto.com
sites.beesknees-photography.com sites.beesknees-photography.com
sites.cathykoop.ca sites.cathykoop.ca
sites.csrarealestatephoto.com sites.csrarealestatephoto.com
sites.dynamictours.ca sites.dynamictours.ca
sites.eastbayrealestatevideos.com sites.eastbayrealestatevideos.com
sites.elevotix.com sites.elevotix.com
sites.explorify3d.com sites.explorify3d.com
sites.flylisted.com sites.flylisted.com
sites.hangtime27.com sites.hangtime27.com
sites.harmonps.com sites.harmonps.com
sites.home-views.com sites.home-views.com
sites.homejab.com sites.homejab.com
sites.i3dtours.com sites.i3dtours.com
sites.limestmedia.com sites.limestmedia.com
sites.listing-standard.com sites.listing-standard.com
sites.mccourtneyphotographics.com sites.mccourtneyphotographics.com
sites.oneshotprods.com sites.oneshotprods.com
sites.pdxrealestatetours.com sites.pdxrealestatetours.com
sites.precipitousimaging.com sites.precipitousimaging.com
sites.quickcloselistings.com sites.quickcloselistings.com
sites.realpatience.com sites.realpatience.com
sites.scatterscape.com sites.scatterscape.com
sites.skyshotstudios.com sites.skyshotstudios.com
sites.solpix.co sites.solpix.co
sites.sparksmediagroup.com sites.sparksmediagroup.com
sites.tcvtours3d.com sites.tcvtours3d.com
sites.trueonegroup.com sites.trueonegroup.com
sites.trueperceptionimages.com sites.trueperceptionimages.com
sites.vantagemediaproductions.com sites.vantagemediaproductions.com
sites.visionnj.com sites.visionnj.com
assemblyliving.com assemblyliving.com
10979chalonroad.net 10979chalonroad.net
1234address.com 1234address.com
templates.lunghimediagroup.com templates.lunghimediagroup.com
tour.seacoastrephotography.com tour.seacoastrephotography.com
tours.amazingphotovideo.com tours.amazingphotovideo.com
tours.blueoceanmiami.com tours.blueoceanmiami.com
tours.dronetoursllc.com tours.dronetoursllc.com
tours.justaskjask.com tours.justaskjask.com
tours.newvisionstudio.com tours.newvisionstudio.com
tours.photoconnor.com tours.photoconnor.com
tours.srq360media.com tours.srq360media.com
tours.vrsquadinc.com tours.vrsquadinc.com
user.vividvm.com user.vividvm.com
virtualtour.c21colonial.ca virtualtour.c21colonial.ca
westgissingroad.com westgissingroad.com
u.listvt.com u.listvt.com
clients.cre8r.agency clients.cre8r.agency
clients.jackvatcherphotography.com clients.jackvatcherphotography.com
featured.islandsothebysrealty.com featured.islandsothebysrealty.com
homes.btwimages.com homes.btwimages.com
homes.ejp.photo homes.ejp.photo
homes.motioncitymedia.com homes.motioncitymedia.com
irownwoodcrossingqc.com irownwoodcrossingqc.com
kensingtontic.com kensingtontic.com
listedhq.com listedhq.com
listing.hiverealestatemedia.com listing.hiverealestatemedia.com
listing.morrisonteam.com listing.morrisonteam.com
listing.trevisuality.com listing.trevisuality.com
listings.bokomedia.com listings.bokomedia.com
listings.homevideorealestate.com listings.homevideorealestate.com
listings.picpros.ca listings.picpros.ca
listings.zuwerksphotography.com listings.zuwerksphotography.com
listvt.com listvt.com
login.aimmedia.group login.aimmedia.group
login.treefort-media.com login.treefort-media.com
lwopenhouse.com lwopenhouse.com
oldesouthva.com oldesouthva.com
properties.scherbamedia.com properties.scherbamedia.com
SITES.HOMEJAB.COM
IP History

Click the IP addresses to see over domains using them.