Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

THEOUTPOSTESTATE.COM

THEOUTPOSTESTATE.COM
Shared Attributes
Domain
fdimedia.com listing.fdimedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 53 days
otbxair.com listing.otbxair.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 172 days
aerialcanvas.com listings.aerialcanvas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 191 days
axtonandliv.com listings.axtonandliv.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 141 days
docprops.com listings.docprops.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 148 days
realtyexecutivesbw.com listings.realtyexecutivesbw.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 122 days
snapsharks.com listings.snapsharks.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 183 days
thergbstudios.com listings.thergbstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 185 days
vastmediaspace.com listings.vastmediaspace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 187 days
westrobin.com listings.westrobin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 188 days
aperturemedia.io live.aperturemedia.io
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 193 days
kuperrealty.com live.kuperrealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
luxehomestyles.com luxehomestyles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 206 days
lwvhome.com lwvhome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 21 days
madrone118.com madrone118.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 108 days
cincyvisuals.com media.cincyvisuals.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 197 days
openhouse360.com media.openhouse360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 172 days
remco.solutions media.remco.solutions
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 178 days
estatephotos.la mylisting.estatephotos.la
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 53 days
orion3dstudios.com myspaceport.orion3dstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 172 days
ranchobuenavidatexas.com ranchobuenavidatexas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 58 days
nwhomestyleslifestyle.com nwhomestyleslifestyle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 One Off
palmiahomesforsale.com palmiahomesforsale.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jun 2024 187 days
lresmarketing.com photos.lresmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 187 days
scrug.gs portfolio.scrug.gs
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 180 days
aspectvisuals.co properties.aspectvisuals.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 53 days
shftgroup.ca properties.shftgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 181 days
spectrumrealestatephotography.com properties.spectrumrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 127 days
jdpworks.com remedia.jdpworks.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 160 days
rent1313sealway.com rent1313sealway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 238 days
scenicdriveestate.com scenicdriveestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Mar 2024 109 days
seasidepearlfarmgatewinery.info seasidepearlfarmgatewinery.info
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 236 days
adioimages.com sites.adioimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 191 days
allmediatours.com sites.allmediatours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 192 days
ardentmediagroup.ca sites.ardentmediagroup.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 193 days
austinlistingphotos.com sites.austinlistingphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 45 days
bluebruinphotography.com sites.bluebruinphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 9 days
changeovermedia.com sites.changeovermedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 197 days
craigsauer3d.com sites.craigsauer3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 198 days
discoveraerial.com sites.discoveraerial.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 148 days
elevatedphotos.ca sites.elevatedphotos.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 52 days
firelightimages.com sites.firelightimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 153 days
flywithsas.com sites.flywithsas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 153 days
fullbarsmedia.com sites.fullbarsmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 154 days
gestaltgroup.com sites.gestaltgroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Mar 2024 99 days
helicopix.com sites.helicopix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 157 days
highfivemediapro.com sites.highfivemediapro.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 157 days
homelaunch.ca sites.homelaunch.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 158 days
jpmrealestatephotography.com sites.jpmrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 161 days
lunghistudio.com sites.lunghistudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 189 days
matthewjamesphoto.ca sites.matthewjamesphoto.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 166 days
odyssey3d.ca sites.odyssey3d.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 171 days
realtronaccelerate.ca sites.realtronaccelerate.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 177 days
relahqdemo.com sites.relahqdemo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 177 days
ruummedia.com sites.ruummedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 179 days
siliconvalleyphotos.com sites.siliconvalleyphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 182 days
sjvirtualtours.ca sites.sjvirtualtours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 182 days
taftpix.com sites.taftpix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 128 days
taylorallancreative.com sites.taylorallancreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 184 days
tracycolburn.com sites.tracycolburn.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 1 day
uniquemediadesign.com sites.uniquemediadesign.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
wtcreative.com sites.wtcreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 189 days
1142nvenetiandr.com 1142nvenetiandr.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Jun 2024 64 days
123iconstreet.com 123iconstreet.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
145robbyln.com 145robbyln.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Jun 2024 117 days
stonewellcourt.com stonewellcourt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 56 days
15475east191st.com 15475east191st.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2024 Jun 2024 26 days
api360.ca tour.api360.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 193 days
benaccinelli.com tours.benaccinelli.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
curb360.com tours.curb360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 49 days
vogelcreative.ca tours.vogelcreative.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 187 days
veeshome.com veeshome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 254 days
casadirame.com casadirame.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 254 days
brubeckhouse.com brubeckhouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 244 days
casaonpennell.com casaonpennell.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Jun 2024 208 days
aw360.me my.aw360.me
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 141 days
designerhomestyles.com designerhomestyles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Apr 2024 155 days
glass7thfloor.com glass7thfloor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 102 days
harecreekterrace.com harecreekterrace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 56 days
hometour.me hometour.me
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 56 days
innerrichmondduplex.com innerrichmondduplex.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 21 days
laurel403.com laurel403.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
listingzen.com listingzen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
livingmdr.com livingmdr.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
lostilosarchitectural.com lostilosarchitectural.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Nov 2021 35 days
malibucolonygem.com malibucolonygem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
mandvilleretreat.com mandvilleretreat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Jan 2022 Feb 2022 49 days
martelheightslease.com martelheightslease.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
orlandocompound.com orlandocompound.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
outpostestate.com outpostestate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 126 days
regatta1114.com regatta1114.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
regatta1506.com regatta1506.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 92 days
regatta1508.com regatta1508.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
regatta509.com regatta509.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
appianhouse.com appianhouse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
rockyoakslodge.com rockyoakslodge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 45 days
santamonicabeachestate.com santamonicabeachestate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 129 days
10037rudnickave.com 10037rudnickave.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1011northbeverlyestate.com 1011northbeverlyestate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1016moraga.com 1016moraga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
10306marchmont.com 10306marchmont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
10417louisiana103.com 10417louisiana103.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1052seco.com 1052seco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
10829winnetkaavenue.com 10829winnetkaavenue.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1082cordova.com 1082cordova.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
11121montana.com 11121montana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 96 days
11257woolford.com 11257woolford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 50 days
1130georgina.com 1130georgina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1135coldwater.com 1135coldwater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 50 days
11457donaevita.com 11457donaevita.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1147gallowayst.com 1147gallowayst.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 96 days
11525orum.com 11525orum.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
11624terryhill.com 11624terryhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
11715goshen-101.com 11715goshen-101.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
11910avonapt2.com 11910avonapt2.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
121junestreet.com 121junestreet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 96 days
1229duplex.com 1229duplex.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Oct 2021 One Off
12359otsego.com 12359otsego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
127bowling.com 127bowling.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1308lucile.com 1308lucile.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 96 days
1350northorangegrove.com 1350northorangegrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
15000mckendree.com 15000mckendree.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 50 days
1507nhoover.com 1507nhoover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1519orange.com 1519orange.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Jan 2022 Feb 2022 29 days
15228depauw.com 15228depauw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1522amherst103.com 1522amherst103.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1604sunsetplazadrive.com 1604sunsetplazadrive.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1607carlyle.com 1607carlyle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1612larco.com 1612larco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1650cicero.com 1650cicero.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 50 days
16648cumbreverde.com 16648cumbreverde.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
16798charmelln.com 16798charmelln.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
thebrentwood322.com thebrentwood322.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
azzurra1104.com azzurra1104.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 106 days
azzurra1701.com azzurra1701.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 120 days
azzurra624.com azzurra624.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
azzurra725.com azzurra725.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
california-ave.com california-ave.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
colonybeachwoodhouse.com colonybeachwoodhouse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
cove1102.com cove1102.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
cove1109.com cove1109.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
cove1401.com cove1401.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
houseonbeach.com houseonbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
liamlatin.com liamlatin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 252 days
lincolnparklawnlust.com lincolnparklawnlust.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 May 2024 173 days
elevatedlistingstx.com listings.elevatedlistingstx.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 98 days
focus-rep.com listings.focus-rep.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 17 days
ground2airmedia.com listings.ground2airmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 103 days
mattpiercephoto.com listings.mattpiercephoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 63 days
nextdoorphotos.com listings.nextdoorphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 117 days
photoreal.ca listings.photoreal.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 174 days
relawldemo.com listings.relawldemo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 177 days
dynamictours.ca login.dynamictours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2024 Feb 2024 52 days
goosemediagroup.com login.goosemediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 155 days
revedio.com myrevedio.revedio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 178 days
palmiahomeforsale.com palmiahomeforsale.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 18 days
laidlawphotography.com photos.laidlawphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 60 days
aremacphotography.com portal.aremacphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 193 days
lalush.com properties.lalush.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 60 days
ranchesatsentinelpeaktract3.com ranchesatsentinelpeaktract3.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 54 days
ritzcarltonvilla810.com ritzcarltonvilla810.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Mar 2024 108 days
castrocondo.com castrocondo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 92 days
photographervince.com agent.photographervince.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Nov 2023 One Off
artesiantitle.com sites.artesiantitle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 7 days
capturereality.io sites.capturereality.io
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 196 days
coremarketingconcepts.com sites.coremarketingconcepts.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 198 days
dreamhomeimages.com sites.dreamhomeimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 149 days
elevatovisuals.com sites.elevatovisuals.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 52 days
fullframecreativeagency.com sites.fullframecreativeagency.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
genesisvue.com sites.genesisvue.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 154 days
happyhousegta.com sites.happyhousegta.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 56 days
jmphilms.com sites.jmphilms.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 161 days
kianikanstudio.ca sites.kianikanstudio.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 139 days
liftecmedia.com sites.liftecmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 172 days
listvt.com sites.listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 178 days
lounny.com sites.lounny.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 185 days
realtoursswfl.com sites.realtoursswfl.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 177 days
richmountcreative.com sites.richmountcreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 178 days
royaltystudios.co sites.royaltystudios.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 179 days
shutterlist.com sites.shutterlist.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 182 days
slevinhurtado.com sites.slevinhurtado.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Apr 2024 148 days
snapairphoto.com sites.snapairphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 183 days
southbaypics.com sites.southbaypics.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 183 days
virtualview360.com sites.virtualview360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 187 days
walters.photography sites.walters.photography
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 188 days
willventuresphoto.com sites.willventuresphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 188 days
skye30a.com skye30a.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Jun 2024 220 days
1077rankin.com 1077rankin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 136 days
13908hutchinsonplace.com 13908hutchinsonplace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Dec 2023 One Off
stonecrestlaketahoe.com stonecrestlaketahoe.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 254 days
verticalmediatx.com agent.verticalmediatx.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 131 days
surfclub410.com surfclub410.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Jun 2024 70 days
thehomeonvashon.com thehomeonvashon.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 229 days
themusehouse.com themusehouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 May 2024 201 days
theoneinseattle.com theoneinseattle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 126 days
chadjonesphoto.com tour.chadjonesphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 145 days
digenovamedia.ca tour.digenovamedia.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 96 days
shutterhouse.ca tour.shutterhouse.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 182 days
augmentum.ca virtualtours.augmentum.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 194 days
28photos.com realestate.28photos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
topdownphotos.com my.topdownphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 55 days
784design.com client.784design.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 191 days
crephotos.com client.crephotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 198 days
redheiferproductions.com clientportal.redheiferproductions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 122 days
coastalrealestatemedia.com clients.coastalrealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 197 days
glass9thfloor.com glass9thfloor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 33 days
grandsummitranch.com grandsummitranch.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 254 days
teamcirca.com homes.teamcirca.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 184 days
imperialhousephb.com imperialhousephb.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 30 days
embouldin.com embouldin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Jun 2024 46 days
lacostabuffandhensman.com lacostabuffandhensman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
mandevillelife.com mandevillelife.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
mandevilleretreat.com mandevilleretreat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
moragaterrace.com moragaterrace.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
ocean7d.com ocean7d.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
regatta1507.com regatta1507.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
regatta503.com regatta503.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
regatta704.com regatta704.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
pointdumeretreat.com pointdumeretreat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 127 days
alsacespanish.com alsacespanish.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 122 days
1043svictoria.com 1043svictoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
10922verano.com 10922verano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Jan 2022 Feb 2022 29 days
11257woodford.com 11257woodford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 50 days
1128edgeware.com 1128edgeware.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 58 days
11318donapegita.com 11318donapegita.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1131towerlot.com 1131towerlot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 50 days
1155sgrandave1910.com 1155sgrandave1910.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Oct 2021 One Off
11587hortense.com 11587hortense.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
1158halfmadison.com 1158halfmadison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1161fiske.com 1161fiske.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 96 days
1172halfwestmoreland.com 1172halfwestmoreland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
11812gorham202.com 11812gorham202.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 96 days
12020guerinstreet.com 12020guerinstreet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
120mccadden.com 120mccadden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
120northmccadden.com 120northmccadden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
120spalm201.com 120spalm201.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1210kings104.com 1210kings104.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
12317viewvilla.com 12317viewvilla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Oct 2021 One Off
1232and1234stradella.com 1232and1234stradella.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
127gower.com 127gower.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
12831mulholland.com 12831mulholland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1310lucileave.com 1310lucileave.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
137gardner.com 137gardner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
13926sunset.com 13926sunset.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1395allison.com 1395allison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1435crestdr.com 1435crestdr.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1491oakgrovedrive.com 1491oakgrovedrive.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
1503w66th.com 1503w66th.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
15152hesby.com 15152hesby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
15265bestor.com 15265bestor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
15504casiano.com 15504casiano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
15924northfield.com 15924northfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 96 days
1600ogden.com 1600ogden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1653countryclub.com 1653countryclub.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
16798charmel.com 16798charmel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
16821edgarstreet.com 16821edgarstreet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 58 days
1712westridge.com 1712westridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1748correa.com 1748correa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
surfbarnmalibu.com surfbarnmalibu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
suttonwayregency.com suttonwayregency.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
tampa-downtown.com tampa-downtown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
tdandrews.com tdandrews.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
theazzurra725.com theazzurra725.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
theburnellhouse.com theburnellhouse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 82 days
azzurra325.com azzurra325.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
azzurra1616.com azzurra1616.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
thehillcountryschool.com thehillcountryschool.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Jan 2022 Feb 2022 34 days
tigertail555.com tigertail555.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
barbaraandbennett.com barbaraandbennett.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 107 days
bisonmalibu.com bisonmalibu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Nov 2021 Feb 2022 119 days
villaorlandoweho.com villaorlandoweho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 130 days
warnercentercondo-themet.com warnercentercondo-themet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 129 days
castelloresidence.com castelloresidence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
coldwaterestate.com coldwaterestate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
cove1203.com cove1203.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Nov 2021 17 days
cove1402.com cove1402.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
cove604.com cove604.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 68 days
cove902.com cove902.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 68 days
fairmontcenturyplazaresidence.com fairmontcenturyplazaresidence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Nov 2021 Feb 2022 110 days
fourseasonsresidencela.com fourseasonsresidencela.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
spectrumrealestatephotography.com remaxadvance.spectrumrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 127 days
acreagehomeinredmond.com acreagehomeinredmond.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 85 days
seasidesandsinnmotel.com seasidesandsinnmotel.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 236 days
aimagery.com site.aimagery.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 192 days
aeriousplus.com sites.aeriousplus.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 191 days
calrealestatemedia.com sites.calrealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 196 days
craigbernardi.com sites.craigbernardi.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 198 days
curbviews.com sites.curbviews.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 146 days
digitalhometours.ca sites.digitalhometours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 135 days
discovervirtual360.com sites.discovervirtual360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 148 days
dronehomemedia.com sites.dronehomemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 149 days
dustinclyde.com sites.dustinclyde.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 149 days
housepics4u.ca sites.housepics4u.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 158 days
ictimaging.com sites.ictimaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 206 days
inhabitphotography.com sites.inhabitphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 159 days
intextphotography.com sites.intextphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 159 days
itsrealestatepropertyservices.com sites.itsrealestatepropertyservices.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 107 days
keesnap.com sites.keesnap.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 23 days
megmediagroup.com sites.megmediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 167 days
nausetmedia.com sites.nausetmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 170 days
njpropertypix.com sites.njpropertypix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 37 days
pantheraaerial.com sites.pantheraaerial.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 174 days
pdxdan.com sites.pdxdan.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 120 days
porticomedia.net sites.porticomedia.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 175 days
primeremedia.net sites.primeremedia.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 175 days
radiantphotovideo.com sites.radiantphotovideo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 177 days
refleximaging.com sites.refleximaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 177 days
seattleprophotography.com sites.seattleprophotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 180 days
shadowpointmedia.com sites.shadowpointmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 181 days
showingaustin.com sites.showingaustin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 125 days
staceyhennessy.com sites.staceyhennessy.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 183 days
trifectamediasd.com sites.trifectamediasd.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 37 days
virtourmedia.com sites.virtourmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 187 days
vmdpros.com sites.vmdpros.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 One Off
youngrealtymedia.com sites.youngrealtymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 107 days
avegbythesea.com avegbythesea.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 246 days
10021686west13avenue.com 10021686west13avenue.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 5 days
103fairviewchurch.com 103fairviewchurch.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Jun 2024 118 days
106-bixby-hill.com 106-bixby-hill.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 34 days
129turnberryway.com 129turnberryway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 5 days
12jacquelineroadunitc.com 12jacquelineroadunitc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 84 days
13longview.com 13longview.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2024 Jun 2024 14 days
1507mefferdave.com 1507mefferdave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 42 days
amazinglistingphotos.com tour.amazinglistingphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 193 days
virtualrevolutionllc.com tour.virtualrevolutionllc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 187 days
zipp3d.com tours.zipp3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 189 days
bigtamview.com bigtamview.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 245 days
vannnoord.com vannnoord.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 252 days
luxoriginal.com virtualtours.luxoriginal.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 25 days
toddsfotos.com vtours.toddsfotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 186 days
igm-realestate.com booking.igm-realestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Mar 2024 101 days
arborvisualmedia.com websites.arborvisualmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 193 days
buybuchanen.com buybuchanen.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 92 days
canariasdoral4439nw81ave.com canariasdoral4439nw81ave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 47 days
victoriarealestatemarketing.tv s.victoriarealestatemarketing.tv
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 187 days
fullframehometours.com client.fullframehometours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 154 days
huscp.com client.huscp.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 158 days
seancarrie.com client.seancarrie.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 180 days
moorestudios.com clients.moorestudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 141 days
goldcanyonazland.com goldcanyonazland.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 18 days
grandlakevilla.com grandlakevilla.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 254 days
greenfielddr.com greenfielddr.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 209 days
venturesir.com home.venturesir.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 187 days
dallaspro.com homes.dallaspro.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 202 days
aftertecai.com hostedby.aftertecai.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 191 days
imperialhousepha.com imperialhousepha.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 30 days
lakeforestparkmidcenturygem.com lakeforestparkmidcenturygem.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jun 2024 194 days
letitacrest.com letitacrest.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 87 days
mhv.co listedhq.mhv.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 167 days
im3rdmedia.com listing.im3rdmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 158 days
invznmedia.com listing.invznmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 159 days
listing4.com listing4.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 177 days
alleganymedia.com listings.alleganymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 44 days
allieweaverinteriors.com listings.allieweaverinteriors.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 44 days
demophotog.com listings.demophotog.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 205 days
denpg.com listings.denpg.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 147 days
dfwvt.com listings.dfwvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 148 days
framexstudio.com listings.framexstudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 153 days
paidtogether.com listings.paidtogether.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 173 days
revolrealestate.com listings.revolrealestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 178 days
splicerealty.com listings.splicerealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 One Off
atozmedia.ca login.atozmedia.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 One Off
jfarrismedia.com login.jfarrismedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2024 Mar 2024 53 days
russlyon.com lux.russlyon.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 41 days
lwdreamhome.com lwdreamhome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 92 days
propermeasure.com media.propermeasure.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 176 days
movingyouintherightdirection.com movingyouintherightdirection.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 247 days
orion3d.studio myspaceport.orion3d.studio
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 172 days
nurmiisles.com nurmiisles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 254 days
ricoretreat.com ricoretreat.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Jun 2024 131 days
plantationpoimtsouth.com plantationpoimtsouth.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 162 days
johnruzphoto.com portal.johnruzphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Mar 2024 103 days
local-shot.com portal.local-shot.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 182 days
brookfieldphotographer.com property.brookfieldphotographer.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 195 days
relahq.com relahq.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 254 days
regatta1412.com regatta1412.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
regatta815.com regatta815.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
akangelloft.com akangelloft.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
10537louisiana.com 10537louisiana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Oct 2021 One Off
10831farragut.com 10831farragut.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
11064charnock.com 11064charnock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
11106hortense.com 11106hortense.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Oct 2021 One Off
1115charmacres.com 1115charmacres.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Oct 2021 One Off
1117embury.com 1117embury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1118charm.com 1118charm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1147galloway.com 1147galloway.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 96 days
1152wilcox.com 1152wilcox.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1174westmoreland.com 1174westmoreland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
11828shirewycliffe.com 11828shirewycliffe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
11910-11912wagner.com 11910-11912wagner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
11940tabor.com 11940tabor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
11956weir.com 11956weir.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
1209tellem.com 1209tellem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
12275sky.com 12275sky.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1230princeton.com 1230princeton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 50 days
1237villawoods.com 1237villawoods.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Oct 2021 8 days
12623villa.com 12623villa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 96 days
12937walsh.com 12937walsh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
12seaviewterrace.com 12seaviewterrace.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1300comstock.com 1300comstock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
130512thst.com 130512thst.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
1320princeton203.com 1320princeton203.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1385allison.com 1385allison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
14722tudorchase.com 14722tudorchase.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1478crescentheights.com 1478crescentheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
14958mayall.com 14958mayall.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
15154mulholland.com 15154mulholland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1602silverwoodterrace.com 1602silverwoodterrace.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1638gramercy.com 1638gramercy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 96 days
16706montealto.com 16706montealto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1728washingtonway.com 1728washingtonway.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 124 days
theazzurra323.com theazzurra323.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 99 days
azzurra1224.com azzurra1224.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
azzurra731.com azzurra731.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
townhoused.com townhoused.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 132 days
westhollywoodcompound.com westhollywoodcompound.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 51 days
casamonica3.com casamonica3.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Nov 2021 Feb 2022 117 days
colehousesunset.com colehousesunset.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
corralcanyonhomes.com corralcanyonhomes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
cove1106.com cove1106.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
futureazzurra1616.com futureazzurra1616.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
jubilodubois.com jubilodubois.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Nov 2021 31 days
luxuryvenicebeachrental.estate luxuryvenicebeachrental.estate
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
marinacityclub145.com marinacityclub145.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
modjeskamodern.com modjeskamodern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Nov 2021 Feb 2022 96 days
mountwashingtonmodern.com mountwashingtonmodern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 123 days
1122charmacres.com 1122charmacres.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 58 days
azzurra1402.com azzurra1402.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
thedowntowncreative.com request.thedowntowncreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 185 days
3eyemedia.com sites.3eyemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
5dgmedia.com sites.5dgmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 84 days
acreagency.com sites.acreagency.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 42 days
architaraphoto.com sites.architaraphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 193 days
beesknees-photography.com sites.beesknees-photography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Apr 2024 105 days
cathykoop.ca sites.cathykoop.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 52 days
eastbayrealestatevideos.com sites.eastbayrealestatevideos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 149 days
elevotix.com sites.elevotix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Feb 2024 98 days
explorify3d.com sites.explorify3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 151 days
flylisted.com sites.flylisted.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 153 days
hangtime27.com sites.hangtime27.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 156 days
harmonps.com sites.harmonps.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 157 days
home-views.com sites.home-views.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 158 days
homejab.com sites.homejab.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
i3dtours.com sites.i3dtours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 158 days
limestmedia.com sites.limestmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 111 days
listing-standard.com sites.listing-standard.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 178 days
mccourtneyphotographics.com sites.mccourtneyphotographics.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 167 days
oneshotprods.com sites.oneshotprods.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 172 days
pdxrealestatetours.com sites.pdxrealestatetours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 174 days
precipitousimaging.com sites.precipitousimaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Mar 2024 107 days
quickcloselistings.com sites.quickcloselistings.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 176 days
realpatience.com sites.realpatience.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 122 days
scatterscape.com sites.scatterscape.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 180 days
skyshotstudios.com sites.skyshotstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 182 days
solpix.co sites.solpix.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 254 days
sparksmediagroup.com sites.sparksmediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 183 days
tcvtours3d.com sites.tcvtours3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 184 days
trueonegroup.com sites.trueonegroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 186 days
trueperceptionimages.com sites.trueperceptionimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 186 days
vantagemediaproductions.com sites.vantagemediaproductions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 One Off
visionnj.com sites.visionnj.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 133 days
assemblyliving.com assemblyliving.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 254 days
10979chalonroad.net 10979chalonroad.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 254 days
1234address.com 1234address.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
lunghimediagroup.com templates.lunghimediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 189 days
seacoastrephotography.com tour.seacoastrephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 180 days
amazingphotovideo.com tours.amazingphotovideo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 44 days
blueoceanmiami.com tours.blueoceanmiami.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 195 days
dronetoursllc.com tours.dronetoursllc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 149 days
justaskjask.com tours.justaskjask.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 161 days
newvisionstudio.com tours.newvisionstudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 206 days
photoconnor.com tours.photoconnor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 174 days
srq360media.com tours.srq360media.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 183 days
vrsquadinc.com tours.vrsquadinc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 188 days
vividvm.com user.vividvm.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 133 days
c21colonial.ca virtualtour.c21colonial.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 92 days
westgissingroad.com westgissingroad.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 May 2024 224 days
listvt.com u.listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 178 days
cre8r.agency clients.cre8r.agency
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Apr 2024 52 days
jackvatcherphotography.com clients.jackvatcherphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 107 days
comehometotheone.com comehometotheone.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2024 Apr 2024 One Off
islandsothebysrealty.com featured.islandsothebysrealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
btwimages.com homes.btwimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
ejp.photo homes.ejp.photo
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 150 days
motioncitymedia.com homes.motioncitymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 190 days
irownwoodcrossingqc.com irownwoodcrossingqc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Dec 2023 One Off
kensingtontic.com kensingtontic.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024 254 days
launiupokohome.com launiupokohome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2024 Jun 2024 32 days
listedhq.com listedhq.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 177 days
hiverealestatemedia.com listing.hiverealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 157 days
morrisonteam.com listing.morrisonteam.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 169 days
trevisuality.com listing.trevisuality.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 186 days
bokomedia.com listings.bokomedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 9 days
homevideorealestate.com listings.homevideorealestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Nov 2023 56 days
picpros.ca listings.picpros.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 175 days
zuwerksphotography.com listings.zuwerksphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 189 days
listvt.com listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 178 days
aimmedia.group login.aimmedia.group
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 192 days
treefort-media.com login.treefort-media.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Apr 2024 186 days
lwopenhouse.com lwopenhouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 May 2024 222 days
oldesouthva.com oldesouthva.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 19 days
scherbamedia.com properties.scherbamedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Mar 2024 180 days
santamonicatownhome.com santamonicatownhome.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1003northiguala.com 1003northiguala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
1016orlando.com 1016orlando.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1020casiano.com 1020casiano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1024marengo.com 1024marengo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
10490wilshire1506.com 10490wilshire1506.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
10805blixst.com 10805blixst.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
1110outlook.com 1110outlook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1125monument.com 1125monument.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1131miradero.com 1131miradero.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
11523meridianpoint.com 11523meridianpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 50 days
116southvista.com 116southvista.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
11805bellagio.com 11805bellagio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1181carmonaave.com 1181carmonaave.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 96 days
12015roycewaterford.com 12015roycewaterford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
12311deerbrook.com 12311deerbrook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
123doheny.com 123doheny.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1270lagovista.com 1270lagovista.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
129edinburgh.com 129edinburgh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Oct 2021 One Off
129topsailmall.com 129topsailmall.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1310halflucileave.com 1310halflucileave.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1324stradella.com 1324stradella.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 75 days
13322maxella4.com 13322maxella4.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1338warner.com 1338warner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Jan 2022 Feb 2022 29 days
13574deste.com 13574deste.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
13601valeriost.com 13601valeriost.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1393allison.com 1393allison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1417lowerpaseo.com 1417lowerpaseo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1427georgina.com 1427georgina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
14525mirabellevista.com 14525mirabellevista.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Oct 2021 One Off
14608mondavi.com 14608mondavi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
1508georginaave.com 1508georginaave.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 50 days
1509hoover.com 1509hoover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Oct 2021 One Off
1520harle.com 1520harle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
15919temecula.com 15919temecula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Jan 2022 Feb 2022 29 days
1622alvira.com 1622alvira.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 58 days
1625queensroad.com 1625queensroad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 125 days
16815livorno.com 16815livorno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1728w39thstreet.com 1728w39thstreet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 124 days
17520revello.com 17520revello.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1752corralcyn.com 1752corralcyn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
1785belairroad.com 1785belairroad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 104 days
theazzurra1531.com theazzurra1531.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Dec 2021 50 days
theeaglesnestestate.com theeaglesnestestate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
thelaquillaranch.com thelaquillaranch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
thenorthre.com thenorthre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Dec 2021 Feb 2022 82 days
azzurra1024.com azzurra1024.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
azzurra1105.com azzurra1105.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 120 days
azzurra525.com azzurra525.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
behouse203.com behouse203.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
valleyvillagecraftsman.com valleyvillagecraftsman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
caminopalmerostreet.com caminopalmerostreet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
contemporaryonsorrento.com contemporaryonsorrento.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
hiddenvalleybh.com hiddenvalleybh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Nov 2021 Feb 2022 106 days
marinetteestate.com marinetteestate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
pacificpalisadeshome.info pacificpalisadeshome.info
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
parkcrest833.com parkcrest833.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
ptdumehouse.com ptdumehouse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Jan 2022 91 days
reevesbury.com reevesbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
regatta1403.com regatta1403.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
regatta1702.com regatta1702.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-81911516 Oct 2021 Feb 2022 133 days
THEOUTPOSTESTATE.COM
Non IP Attributes
Attribute First Last
IC IC-ZN9P6ZWJ Oct 2023 Jun 2024
UA UA-81911516 Oct 2021 Feb 2022
THEOUTPOSTESTATE.COM
Overlap Attribute Domains
theoutpostestate.com theoutpostestate.com
listing.fdimedia.com listing.fdimedia.com
listing.otbxair.com listing.otbxair.com
listings.aerialcanvas.com listings.aerialcanvas.com
listings.axtonandliv.com listings.axtonandliv.com
listings.docprops.com listings.docprops.com
listings.realtyexecutivesbw.com listings.realtyexecutivesbw.com
listings.snapsharks.com listings.snapsharks.com
listings.thergbstudios.com listings.thergbstudios.com
listings.vastmediaspace.com listings.vastmediaspace.com
listings.westrobin.com listings.westrobin.com
live.aperturemedia.io live.aperturemedia.io
live.kuperrealty.com live.kuperrealty.com
luxehomestyles.com luxehomestyles.com
lwvhome.com lwvhome.com
madrone118.com madrone118.com
media.cincyvisuals.com media.cincyvisuals.com
media.openhouse360.com media.openhouse360.com
media.remco.solutions media.remco.solutions
mylisting.estatephotos.la mylisting.estatephotos.la
myspaceport.orion3dstudios.com myspaceport.orion3dstudios.com
ranchobuenavidatexas.com ranchobuenavidatexas.com
nwhomestyleslifestyle.com nwhomestyleslifestyle.com
palmiahomesforsale.com palmiahomesforsale.com
photos.lresmarketing.com photos.lresmarketing.com
portfolio.scrug.gs portfolio.scrug.gs
properties.aspectvisuals.co properties.aspectvisuals.co
properties.shftgroup.ca properties.shftgroup.ca
properties.spectrumrealestatephotography.com properties.spectrumrealestatephotography.com
remedia.jdpworks.com remedia.jdpworks.com
rent1313sealway.com rent1313sealway.com
scenicdriveestate.com scenicdriveestate.com
seasidepearlfarmgatewinery.info seasidepearlfarmgatewinery.info
sites.adioimages.com sites.adioimages.com
sites.allmediatours.com sites.allmediatours.com
sites.ardentmediagroup.ca sites.ardentmediagroup.ca
sites.austinlistingphotos.com sites.austinlistingphotos.com
sites.bluebruinphotography.com sites.bluebruinphotography.com
sites.changeovermedia.com sites.changeovermedia.com
sites.craigsauer3d.com sites.craigsauer3d.com
sites.discoveraerial.com sites.discoveraerial.com
sites.elevatedphotos.ca sites.elevatedphotos.ca
sites.firelightimages.com sites.firelightimages.com
sites.flywithsas.com sites.flywithsas.com
sites.fullbarsmedia.com sites.fullbarsmedia.com
sites.gestaltgroup.com sites.gestaltgroup.com
sites.helicopix.com sites.helicopix.com
sites.highfivemediapro.com sites.highfivemediapro.com
sites.homelaunch.ca sites.homelaunch.ca
sites.jpmrealestatephotography.com sites.jpmrealestatephotography.com
sites.lunghistudio.com sites.lunghistudio.com
sites.matthewjamesphoto.ca sites.matthewjamesphoto.ca
sites.odyssey3d.ca sites.odyssey3d.ca
sites.realtronaccelerate.ca sites.realtronaccelerate.ca
sites.relahqdemo.com sites.relahqdemo.com
sites.ruummedia.com sites.ruummedia.com
sites.siliconvalleyphotos.com sites.siliconvalleyphotos.com
sites.sjvirtualtours.ca sites.sjvirtualtours.ca
sites.taftpix.com sites.taftpix.com
sites.taylorallancreative.com sites.taylorallancreative.com
sites.tracycolburn.com sites.tracycolburn.com
sites.uniquemediadesign.com sites.uniquemediadesign.com
sites.wtcreative.com sites.wtcreative.com
1142nvenetiandr.com 1142nvenetiandr.com
123iconstreet.com 123iconstreet.com
145robbyln.com 145robbyln.com
stonewellcourt.com stonewellcourt.com
15475east191st.com 15475east191st.com
tour.api360.ca tour.api360.ca
tours.benaccinelli.com tours.benaccinelli.com
tours.curb360.com tours.curb360.com
tours.vogelcreative.ca tours.vogelcreative.ca
veeshome.com veeshome.com
casadirame.com casadirame.com
brubeckhouse.com brubeckhouse.com
casaonpennell.com casaonpennell.com
my.aw360.me my.aw360.me
designerhomestyles.com designerhomestyles.com
glass7thfloor.com glass7thfloor.com
harecreekterrace.com harecreekterrace.com
hometour.me hometour.me
innerrichmondduplex.com innerrichmondduplex.com
laurel403.com laurel403.com
listingzen.com listingzen.com
livingmdr.com livingmdr.com
lostilosarchitectural.com lostilosarchitectural.com
malibucolonygem.com malibucolonygem.com
mandvilleretreat.com mandvilleretreat.com
martelheightslease.com martelheightslease.com
orlandocompound.com orlandocompound.com
outpostestate.com outpostestate.com
regatta1114.com regatta1114.com
regatta1506.com regatta1506.com
regatta1508.com regatta1508.com
regatta509.com regatta509.com
appianhouse.com appianhouse.com
rockyoakslodge.com rockyoakslodge.com
santamonicabeachestate.com santamonicabeachestate.com
10037rudnickave.com 10037rudnickave.com
1011northbeverlyestate.com 1011northbeverlyestate.com
1016moraga.com 1016moraga.com
10306marchmont.com 10306marchmont.com
10417louisiana103.com 10417louisiana103.com
1052seco.com 1052seco.com
10829winnetkaavenue.com 10829winnetkaavenue.com
1082cordova.com 1082cordova.com
11121montana.com 11121montana.com
11257woolford.com 11257woolford.com
1130georgina.com 1130georgina.com
1135coldwater.com 1135coldwater.com
11457donaevita.com 11457donaevita.com
1147gallowayst.com 1147gallowayst.com
11525orum.com 11525orum.com
11624terryhill.com 11624terryhill.com
11715goshen-101.com 11715goshen-101.com
11910avonapt2.com 11910avonapt2.com
121junestreet.com 121junestreet.com
1229duplex.com 1229duplex.com
12359otsego.com 12359otsego.com
127bowling.com 127bowling.com
1308lucile.com 1308lucile.com
1350northorangegrove.com 1350northorangegrove.com
15000mckendree.com 15000mckendree.com
1507nhoover.com 1507nhoover.com
1519orange.com 1519orange.com
15228depauw.com 15228depauw.com
1522amherst103.com 1522amherst103.com
1604sunsetplazadrive.com 1604sunsetplazadrive.com
1607carlyle.com 1607carlyle.com
1612larco.com 1612larco.com
1650cicero.com 1650cicero.com
16648cumbreverde.com 16648cumbreverde.com
16798charmelln.com 16798charmelln.com
thebrentwood322.com thebrentwood322.com
azzurra1104.com azzurra1104.com
azzurra1701.com azzurra1701.com
azzurra624.com azzurra624.com
azzurra725.com azzurra725.com
california-ave.com california-ave.com
colonybeachwoodhouse.com colonybeachwoodhouse.com
cove1102.com cove1102.com
cove1109.com cove1109.com
cove1401.com cove1401.com
houseonbeach.com houseonbeach.com
liamlatin.com liamlatin.com
lincolnparklawnlust.com lincolnparklawnlust.com
listings.elevatedlistingstx.com listings.elevatedlistingstx.com
listings.focus-rep.com listings.focus-rep.com
listings.ground2airmedia.com listings.ground2airmedia.com
listings.mattpiercephoto.com listings.mattpiercephoto.com
listings.nextdoorphotos.com listings.nextdoorphotos.com
listings.photoreal.ca listings.photoreal.ca
listings.relawldemo.com listings.relawldemo.com
login.dynamictours.ca login.dynamictours.ca
login.goosemediagroup.com login.goosemediagroup.com
myrevedio.revedio.com myrevedio.revedio.com
palmiahomeforsale.com palmiahomeforsale.com
photos.laidlawphotography.com photos.laidlawphotography.com
portal.aremacphotography.com portal.aremacphotography.com
properties.lalush.com properties.lalush.com
ranchesatsentinelpeaktract3.com ranchesatsentinelpeaktract3.com
ritzcarltonvilla810.com ritzcarltonvilla810.com
castrocondo.com castrocondo.com
agent.photographervince.com agent.photographervince.com
sites.artesiantitle.com sites.artesiantitle.com
sites.capturereality.io sites.capturereality.io
sites.coremarketingconcepts.com sites.coremarketingconcepts.com
sites.dreamhomeimages.com sites.dreamhomeimages.com
sites.elevatovisuals.com sites.elevatovisuals.com
sites.fullframecreativeagency.com sites.fullframecreativeagency.com
sites.genesisvue.com sites.genesisvue.com
sites.happyhousegta.com sites.happyhousegta.com
sites.jmphilms.com sites.jmphilms.com
sites.kianikanstudio.ca sites.kianikanstudio.ca
sites.liftecmedia.com sites.liftecmedia.com
sites.listvt.com sites.listvt.com
sites.lounny.com sites.lounny.com
sites.realtoursswfl.com sites.realtoursswfl.com
sites.richmountcreative.com sites.richmountcreative.com
sites.royaltystudios.co sites.royaltystudios.co
sites.shutterlist.com sites.shutterlist.com
sites.slevinhurtado.com sites.slevinhurtado.com
sites.snapairphoto.com sites.snapairphoto.com
sites.southbaypics.com sites.southbaypics.com
sites.virtualview360.com sites.virtualview360.com
sites.walters.photography sites.walters.photography
sites.willventuresphoto.com sites.willventuresphoto.com
skye30a.com skye30a.com
1077rankin.com 1077rankin.com
13908hutchinsonplace.com 13908hutchinsonplace.com
stonecrestlaketahoe.com stonecrestlaketahoe.com
agent.verticalmediatx.com agent.verticalmediatx.com
surfclub410.com surfclub410.com
thehomeonvashon.com thehomeonvashon.com
themusehouse.com themusehouse.com
theoneinseattle.com theoneinseattle.com
tour.chadjonesphoto.com tour.chadjonesphoto.com
tour.digenovamedia.ca tour.digenovamedia.ca
tour.shutterhouse.ca tour.shutterhouse.ca
virtualtours.augmentum.ca virtualtours.augmentum.ca
realestate.28photos.com realestate.28photos.com
my.topdownphotos.com my.topdownphotos.com
client.784design.com client.784design.com
client.crephotos.com client.crephotos.com
clientportal.redheiferproductions.com clientportal.redheiferproductions.com
clients.coastalrealestatemedia.com clients.coastalrealestatemedia.com
glass9thfloor.com glass9thfloor.com
grandsummitranch.com grandsummitranch.com
homes.teamcirca.com homes.teamcirca.com
imperialhousephb.com imperialhousephb.com
embouldin.com embouldin.com
lacostabuffandhensman.com lacostabuffandhensman.com
mandevillelife.com mandevillelife.com
mandevilleretreat.com mandevilleretreat.com
moragaterrace.com moragaterrace.com
ocean7d.com ocean7d.com
regatta1507.com regatta1507.com
regatta503.com regatta503.com
regatta704.com regatta704.com
pointdumeretreat.com pointdumeretreat.com
alsacespanish.com alsacespanish.com
1043svictoria.com 1043svictoria.com
10922verano.com 10922verano.com
11257woodford.com 11257woodford.com
1128edgeware.com 1128edgeware.com
11318donapegita.com 11318donapegita.com
1131towerlot.com 1131towerlot.com
1155sgrandave1910.com 1155sgrandave1910.com
11587hortense.com 11587hortense.com
1158halfmadison.com 1158halfmadison.com
1161fiske.com 1161fiske.com
1172halfwestmoreland.com 1172halfwestmoreland.com
11812gorham202.com 11812gorham202.com
12020guerinstreet.com 12020guerinstreet.com
120mccadden.com 120mccadden.com
120northmccadden.com 120northmccadden.com
120spalm201.com 120spalm201.com
1210kings104.com 1210kings104.com
12317viewvilla.com 12317viewvilla.com
1232and1234stradella.com 1232and1234stradella.com
127gower.com 127gower.com
12831mulholland.com 12831mulholland.com
1310lucileave.com 1310lucileave.com
137gardner.com 137gardner.com
13926sunset.com 13926sunset.com
1395allison.com 1395allison.com
1435crestdr.com 1435crestdr.com
1491oakgrovedrive.com 1491oakgrovedrive.com
1503w66th.com 1503w66th.com
15152hesby.com 15152hesby.com
15265bestor.com 15265bestor.com
15504casiano.com 15504casiano.com
15924northfield.com 15924northfield.com
1600ogden.com 1600ogden.com
1653countryclub.com 1653countryclub.com
16798charmel.com 16798charmel.com
16821edgarstreet.com 16821edgarstreet.com
1712westridge.com 1712westridge.com
1748correa.com 1748correa.com
surfbarnmalibu.com surfbarnmalibu.com
suttonwayregency.com suttonwayregency.com
tampa-downtown.com tampa-downtown.com
tdandrews.com tdandrews.com
theazzurra725.com theazzurra725.com
theburnellhouse.com theburnellhouse.com
azzurra325.com azzurra325.com
azzurra1616.com azzurra1616.com
thehillcountryschool.com thehillcountryschool.com
tigertail555.com tigertail555.com
barbaraandbennett.com barbaraandbennett.com
bisonmalibu.com bisonmalibu.com
villaorlandoweho.com villaorlandoweho.com
warnercentercondo-themet.com warnercentercondo-themet.com
castelloresidence.com castelloresidence.com
coldwaterestate.com coldwaterestate.com
cove1203.com cove1203.com
cove1402.com cove1402.com
cove604.com cove604.com
cove902.com cove902.com
fairmontcenturyplazaresidence.com fairmontcenturyplazaresidence.com
fourseasonsresidencela.com fourseasonsresidencela.com
remaxadvance.spectrumrealestatephotography.com remaxadvance.spectrumrealestatephotography.com
acreagehomeinredmond.com acreagehomeinredmond.com
seasidesandsinnmotel.com seasidesandsinnmotel.com
site.aimagery.com site.aimagery.com
sites.aeriousplus.com sites.aeriousplus.com
sites.calrealestatemedia.com sites.calrealestatemedia.com
sites.craigbernardi.com sites.craigbernardi.com
sites.curbviews.com sites.curbviews.com
sites.digitalhometours.ca sites.digitalhometours.ca
sites.discovervirtual360.com sites.discovervirtual360.com
sites.dronehomemedia.com sites.dronehomemedia.com
sites.dustinclyde.com sites.dustinclyde.com
sites.housepics4u.ca sites.housepics4u.ca
sites.ictimaging.com sites.ictimaging.com
sites.inhabitphotography.com sites.inhabitphotography.com
sites.intextphotography.com sites.intextphotography.com
sites.itsrealestatepropertyservices.com sites.itsrealestatepropertyservices.com
sites.keesnap.com sites.keesnap.com
sites.megmediagroup.com sites.megmediagroup.com
sites.nausetmedia.com sites.nausetmedia.com
sites.njpropertypix.com sites.njpropertypix.com
sites.pantheraaerial.com sites.pantheraaerial.com
sites.pdxdan.com sites.pdxdan.com
sites.porticomedia.net sites.porticomedia.net
sites.primeremedia.net sites.primeremedia.net
sites.radiantphotovideo.com sites.radiantphotovideo.com
sites.refleximaging.com sites.refleximaging.com
sites.seattleprophotography.com sites.seattleprophotography.com
sites.shadowpointmedia.com sites.shadowpointmedia.com
sites.showingaustin.com sites.showingaustin.com
sites.staceyhennessy.com sites.staceyhennessy.com
sites.trifectamediasd.com sites.trifectamediasd.com
sites.virtourmedia.com sites.virtourmedia.com
sites.vmdpros.com sites.vmdpros.com
sites.youngrealtymedia.com sites.youngrealtymedia.com
avegbythesea.com avegbythesea.com
10021686west13avenue.com 10021686west13avenue.com
103fairviewchurch.com 103fairviewchurch.com
106-bixby-hill.com 106-bixby-hill.com
129turnberryway.com 129turnberryway.com
12jacquelineroadunitc.com 12jacquelineroadunitc.com
13longview.com 13longview.com
1507mefferdave.com 1507mefferdave.com
tour.amazinglistingphotos.com tour.amazinglistingphotos.com
tour.virtualrevolutionllc.com tour.virtualrevolutionllc.com
tours.zipp3d.com tours.zipp3d.com
bigtamview.com bigtamview.com
vannnoord.com vannnoord.com
virtualtours.luxoriginal.com virtualtours.luxoriginal.com
vtours.toddsfotos.com vtours.toddsfotos.com
booking.igm-realestate.com booking.igm-realestate.com
websites.arborvisualmedia.com websites.arborvisualmedia.com
buybuchanen.com buybuchanen.com
canariasdoral4439nw81ave.com canariasdoral4439nw81ave.com
s.victoriarealestatemarketing.tv s.victoriarealestatemarketing.tv
client.fullframehometours.com client.fullframehometours.com
client.huscp.com client.huscp.com
client.seancarrie.com client.seancarrie.com
clients.moorestudios.com clients.moorestudios.com
goldcanyonazland.com goldcanyonazland.com
grandlakevilla.com grandlakevilla.com
greenfielddr.com greenfielddr.com
home.venturesir.com home.venturesir.com
homes.dallaspro.com homes.dallaspro.com
hostedby.aftertecai.com hostedby.aftertecai.com
imperialhousepha.com imperialhousepha.com
lakeforestparkmidcenturygem.com lakeforestparkmidcenturygem.com
letitacrest.com letitacrest.com
listedhq.mhv.co listedhq.mhv.co
listing.im3rdmedia.com listing.im3rdmedia.com
listing.invznmedia.com listing.invznmedia.com
listing4.com listing4.com
listings.alleganymedia.com listings.alleganymedia.com
listings.allieweaverinteriors.com listings.allieweaverinteriors.com
listings.demophotog.com listings.demophotog.com
listings.denpg.com listings.denpg.com
listings.dfwvt.com listings.dfwvt.com
listings.framexstudio.com listings.framexstudio.com
listings.paidtogether.com listings.paidtogether.com
listings.revolrealestate.com listings.revolrealestate.com
listings.splicerealty.com listings.splicerealty.com
login.atozmedia.ca login.atozmedia.ca
login.jfarrismedia.com login.jfarrismedia.com
lux.russlyon.com lux.russlyon.com
lwdreamhome.com lwdreamhome.com
media.propermeasure.com media.propermeasure.com
movingyouintherightdirection.com movingyouintherightdirection.com
myspaceport.orion3d.studio myspaceport.orion3d.studio
nurmiisles.com nurmiisles.com
ricoretreat.com ricoretreat.com
plantationpoimtsouth.com plantationpoimtsouth.com
portal.johnruzphoto.com portal.johnruzphoto.com
portal.local-shot.com portal.local-shot.com
property.brookfieldphotographer.com property.brookfieldphotographer.com
relahq.com relahq.com
regatta1412.com regatta1412.com
regatta815.com regatta815.com
akangelloft.com akangelloft.com
10537louisiana.com 10537louisiana.com
10831farragut.com 10831farragut.com
11064charnock.com 11064charnock.com
11106hortense.com 11106hortense.com
1115charmacres.com 1115charmacres.com
1117embury.com 1117embury.com
1118charm.com 1118charm.com
1147galloway.com 1147galloway.com
1152wilcox.com 1152wilcox.com
1174westmoreland.com 1174westmoreland.com
11828shirewycliffe.com 11828shirewycliffe.com
11910-11912wagner.com 11910-11912wagner.com
11940tabor.com 11940tabor.com
11956weir.com 11956weir.com
1209tellem.com 1209tellem.com
12275sky.com 12275sky.com
1230princeton.com 1230princeton.com
1237villawoods.com 1237villawoods.com
12623villa.com 12623villa.com
12937walsh.com 12937walsh.com
12seaviewterrace.com 12seaviewterrace.com
1300comstock.com 1300comstock.com
130512thst.com 130512thst.com
1320princeton203.com 1320princeton203.com
1385allison.com 1385allison.com
14722tudorchase.com 14722tudorchase.com
1478crescentheights.com 1478crescentheights.com
14958mayall.com 14958mayall.com
15154mulholland.com 15154mulholland.com
1602silverwoodterrace.com 1602silverwoodterrace.com
1638gramercy.com 1638gramercy.com
16706montealto.com 16706montealto.com
1728washingtonway.com 1728washingtonway.com
theazzurra323.com theazzurra323.com
azzurra1224.com azzurra1224.com
azzurra731.com azzurra731.com
townhoused.com townhoused.com
westhollywoodcompound.com westhollywoodcompound.com
casamonica3.com casamonica3.com
colehousesunset.com colehousesunset.com
corralcanyonhomes.com corralcanyonhomes.com
cove1106.com cove1106.com
futureazzurra1616.com futureazzurra1616.com
jubilodubois.com jubilodubois.com
luxuryvenicebeachrental.estate luxuryvenicebeachrental.estate
marinacityclub145.com marinacityclub145.com
modjeskamodern.com modjeskamodern.com
mountwashingtonmodern.com mountwashingtonmodern.com
1122charmacres.com 1122charmacres.com
azzurra1402.com azzurra1402.com
request.thedowntowncreative.com request.thedowntowncreative.com
sites.3eyemedia.com sites.3eyemedia.com
sites.5dgmedia.com sites.5dgmedia.com
sites.acreagency.com sites.acreagency.com
sites.architaraphoto.com sites.architaraphoto.com
sites.beesknees-photography.com sites.beesknees-photography.com
sites.cathykoop.ca sites.cathykoop.ca
sites.eastbayrealestatevideos.com sites.eastbayrealestatevideos.com
sites.elevotix.com sites.elevotix.com
sites.explorify3d.com sites.explorify3d.com
sites.flylisted.com sites.flylisted.com
sites.hangtime27.com sites.hangtime27.com
sites.harmonps.com sites.harmonps.com
sites.home-views.com sites.home-views.com
sites.homejab.com sites.homejab.com
sites.i3dtours.com sites.i3dtours.com
sites.limestmedia.com sites.limestmedia.com
sites.listing-standard.com sites.listing-standard.com
sites.mccourtneyphotographics.com sites.mccourtneyphotographics.com
sites.oneshotprods.com sites.oneshotprods.com
sites.pdxrealestatetours.com sites.pdxrealestatetours.com
sites.precipitousimaging.com sites.precipitousimaging.com
sites.quickcloselistings.com sites.quickcloselistings.com
sites.realpatience.com sites.realpatience.com
sites.scatterscape.com sites.scatterscape.com
sites.skyshotstudios.com sites.skyshotstudios.com
sites.solpix.co sites.solpix.co
sites.sparksmediagroup.com sites.sparksmediagroup.com
sites.tcvtours3d.com sites.tcvtours3d.com
sites.trueonegroup.com sites.trueonegroup.com
sites.trueperceptionimages.com sites.trueperceptionimages.com
sites.vantagemediaproductions.com sites.vantagemediaproductions.com
sites.visionnj.com sites.visionnj.com
assemblyliving.com assemblyliving.com
10979chalonroad.net 10979chalonroad.net
1234address.com 1234address.com
templates.lunghimediagroup.com templates.lunghimediagroup.com
tour.seacoastrephotography.com tour.seacoastrephotography.com
tours.amazingphotovideo.com tours.amazingphotovideo.com
tours.blueoceanmiami.com tours.blueoceanmiami.com
tours.dronetoursllc.com tours.dronetoursllc.com
tours.justaskjask.com tours.justaskjask.com
tours.newvisionstudio.com tours.newvisionstudio.com
tours.photoconnor.com tours.photoconnor.com
tours.srq360media.com tours.srq360media.com
tours.vrsquadinc.com tours.vrsquadinc.com
user.vividvm.com user.vividvm.com
virtualtour.c21colonial.ca virtualtour.c21colonial.ca
westgissingroad.com westgissingroad.com
u.listvt.com u.listvt.com
clients.cre8r.agency clients.cre8r.agency
clients.jackvatcherphotography.com clients.jackvatcherphotography.com
comehometotheone.com comehometotheone.com
featured.islandsothebysrealty.com featured.islandsothebysrealty.com
homes.btwimages.com homes.btwimages.com
homes.ejp.photo homes.ejp.photo
homes.motioncitymedia.com homes.motioncitymedia.com
irownwoodcrossingqc.com irownwoodcrossingqc.com
kensingtontic.com kensingtontic.com
launiupokohome.com launiupokohome.com
listedhq.com listedhq.com
listing.hiverealestatemedia.com listing.hiverealestatemedia.com
listing.morrisonteam.com listing.morrisonteam.com
listing.trevisuality.com listing.trevisuality.com
listings.bokomedia.com listings.bokomedia.com
listings.homevideorealestate.com listings.homevideorealestate.com
listings.picpros.ca listings.picpros.ca
listings.zuwerksphotography.com listings.zuwerksphotography.com
listvt.com listvt.com
login.aimmedia.group login.aimmedia.group
login.treefort-media.com login.treefort-media.com
lwopenhouse.com lwopenhouse.com
oldesouthva.com oldesouthva.com
properties.scherbamedia.com properties.scherbamedia.com
santamonicatownhome.com santamonicatownhome.com
1003northiguala.com 1003northiguala.com
1016orlando.com 1016orlando.com
1020casiano.com 1020casiano.com
1024marengo.com 1024marengo.com
10490wilshire1506.com 10490wilshire1506.com
10805blixst.com 10805blixst.com
1110outlook.com 1110outlook.com
1125monument.com 1125monument.com
1131miradero.com 1131miradero.com
11523meridianpoint.com 11523meridianpoint.com
116southvista.com 116southvista.com
11805bellagio.com 11805bellagio.com
1181carmonaave.com 1181carmonaave.com
12015roycewaterford.com 12015roycewaterford.com
12311deerbrook.com 12311deerbrook.com
123doheny.com 123doheny.com
1270lagovista.com 1270lagovista.com
129edinburgh.com 129edinburgh.com
129topsailmall.com 129topsailmall.com
1310halflucileave.com 1310halflucileave.com
1324stradella.com 1324stradella.com
13322maxella4.com 13322maxella4.com
1338warner.com 1338warner.com
13574deste.com 13574deste.com
13601valeriost.com 13601valeriost.com
1393allison.com 1393allison.com
1417lowerpaseo.com 1417lowerpaseo.com
1427georgina.com 1427georgina.com
14525mirabellevista.com 14525mirabellevista.com
14608mondavi.com 14608mondavi.com
1508georginaave.com 1508georginaave.com
1509hoover.com 1509hoover.com
1520harle.com 1520harle.com
15919temecula.com 15919temecula.com
1622alvira.com 1622alvira.com
1625queensroad.com 1625queensroad.com
16815livorno.com 16815livorno.com
1728w39thstreet.com 1728w39thstreet.com
17520revello.com 17520revello.com
1752corralcyn.com 1752corralcyn.com
1785belairroad.com 1785belairroad.com
theazzurra1531.com theazzurra1531.com
theeaglesnestestate.com theeaglesnestestate.com
thelaquillaranch.com thelaquillaranch.com
thenorthre.com thenorthre.com
azzurra1024.com azzurra1024.com
azzurra1105.com azzurra1105.com
azzurra525.com azzurra525.com
behouse203.com behouse203.com
valleyvillagecraftsman.com valleyvillagecraftsman.com
caminopalmerostreet.com caminopalmerostreet.com
contemporaryonsorrento.com contemporaryonsorrento.com
hiddenvalleybh.com hiddenvalleybh.com
marinetteestate.com marinetteestate.com
pacificpalisadeshome.info pacificpalisadeshome.info
parkcrest833.com parkcrest833.com
ptdumehouse.com ptdumehouse.com
reevesbury.com reevesbury.com
regatta1403.com regatta1403.com
regatta1702.com regatta1702.com
THEOUTPOSTESTATE.COM
IP History

Click the IP addresses to see over domains using them.