Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

SITES.DISCOVERAERIAL.COM

SITES.DISCOVERAERIAL.COM
Shared Attributes
Domain
fdimedia.com listing.fdimedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Nov 2023 2 years, 150 days
otbxair.com listing.otbxair.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
aerialcanvas.com listings.aerialcanvas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
axtonandliv.com listings.axtonandliv.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2022 Feb 2024 1 year, 275 days
docprops.com listings.docprops.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2022 Feb 2024 1 year, 182 days
grmedia.ca listings.grmedia.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 May 2023 39 days
realtyexecutivesbw.com listings.realtyexecutivesbw.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Feb 2024 2 years, 246 days
snapsharks.com listings.snapsharks.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2021 Feb 2024 2 years, 84 days
thergbstudios.com listings.thergbstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2022 Feb 2024 1 year, 364 days
vastmediaspace.com listings.vastmediaspace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2021 Feb 2024 3 years, 22 days
westrobin.com listings.westrobin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Feb 2024 2 years, 262 days
aperturemedia.io live.aperturemedia.io
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2021 Feb 2024 2 years, 70 days
kuperrealty.com live.kuperrealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
motownproductions.com login.motownproductions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2021 Mar 2022 177 days
luxehomestyles.com luxehomestyles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 144 days
lwvhome.com lwvhome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 21 days
madrone118.com madrone118.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Jan 2024 108 days
cincyvisuals.com media.cincyvisuals.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Feb 2024 339 days
homesellerstudio.com media.homesellerstudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Jan 2023 One Off
openhouse360.com media.openhouse360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 30 days
remco.solutions media.remco.solutions
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Feb 2024 278 days
estatephotos.la mylisting.estatephotos.la
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Nov 2023 2 years, 151 days
orion3dstudios.com myspaceport.orion3dstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2021 Feb 2024 2 years, 341 days
ranchobuenavidatexas.com ranchobuenavidatexas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 58 days
richlonardo.com pages.richlonardo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2023 2 years, 29 days
palmiahomesforsale.com palmiahomesforsale.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 81 days
lresmarketing.com photos.lresmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Feb 2024 2 years, 280 days
scrug.gs portfolio.scrug.gs
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Feb 2024 1 year, 333 days
aspectvisuals.co properties.aspectvisuals.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 8 days
kcrealtymedia.com properties.kcrealtymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2022 Jul 2022 One Off
lumifulmedia.com properties.lumifulmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Sep 2023 40 days
shftgroup.ca properties.shftgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 192 days
spectrumrealestatephotography.com properties.spectrumrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 33 days
jdpworks.com remedia.jdpworks.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2022 Feb 2024 1 year, 270 days
rent1313sealway.com rent1313sealway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 132 days
scenicdriveestate.com scenicdriveestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 77 days
seasidepearlfarmgatewinery.info seasidepearlfarmgatewinery.info
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 130 days
adioimages.com sites.adioimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
agent4m.com sites.agent4m.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2021 Mar 2022 209 days
allmediatours.com sites.allmediatours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 69 days
ardentmediagroup.ca sites.ardentmediagroup.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Feb 2024 274 days
austinlistingphotos.com sites.austinlistingphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Nov 2023 241 days
bluebruinphotography.com sites.bluebruinphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2022 Oct 2023 1 year, 180 days
brookroadphotography.com sites.brookroadphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Feb 2022 229 days
changeovermedia.com sites.changeovermedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2021 Feb 2024 2 years, 191 days
craigsauer3d.com sites.craigsauer3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Feb 2024 2 years, 249 days
elevatedphotos.ca sites.elevatedphotos.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2022 Nov 2023 1 year, 1 day
elite360tours.com sites.elite360tours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2021 Feb 2022 159 days
firelightimages.com sites.firelightimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Feb 2024 2 years, 244 days
flywithsas.com sites.flywithsas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2021 Feb 2024 2 years, 108 days
fullbarsmedia.com sites.fullbarsmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Feb 2024 212 days
gestaltgroup.com sites.gestaltgroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Feb 2024 93 days
helicopix.com sites.helicopix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2022 Feb 2024 1 year, 93 days
highfivemediapro.com sites.highfivemediapro.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2021 Feb 2024 2 years, 167 days
homelaunch.ca sites.homelaunch.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2021 Feb 2024 2 years, 167 days
jpmrealestatephotography.com sites.jpmrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2021 Feb 2024 2 years, 101 days
lunghistudio.com sites.lunghistudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2022 Feb 2024 1 year, 128 days
matthewjamesphoto.ca sites.matthewjamesphoto.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2022 Feb 2024 2 years, 47 days
monarch-hd.com sites.monarch-hd.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Dec 2022 1 year, 311 days
odyssey3d.ca sites.odyssey3d.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Feb 2024 2 years, 275 days
radiusmediacompany.com sites.radiusmediacompany.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2021 May 2022 297 days
realtronaccelerate.ca sites.realtronaccelerate.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2021 Feb 2024 2 years, 227 days
redluxury.com sites.redluxury.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2022 Dec 2022 151 days
relahqdemo.com sites.relahqdemo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
ruummedia.com sites.ruummedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Feb 2024 316 days
siliconvalleyphotos.com sites.siliconvalleyphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2022 Feb 2024 1 year, 331 days
sjvirtualtours.ca sites.sjvirtualtours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2021 Feb 2024 2 years, 217 days
taftpix.com sites.taftpix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2022 Feb 2024 1 year, 345 days
taylorallancreative.com sites.taylorallancreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 329 days
tracycolburn.com sites.tracycolburn.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2022 Oct 2023 331 days
uniquemediadesign.com sites.uniquemediadesign.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 321 days
visualistmedia.com sites.visualistmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2022 Jul 2022 168 days
wtcreative.com sites.wtcreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Feb 2024 1 year, 360 days
wymangentry.com sites.wymangentry.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Jan 2022 232 days
104mirasolct.com 104mirasolct.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Sep 2023 One Off
123iconstreet.com 123iconstreet.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Feb 2024 1 year, 359 days
145robbyln.com 145robbyln.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 11 days
stonewellcourt.com stonewellcourt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 21 days
theoutpostestate.com theoutpostestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 148 days
api360.ca tour.api360.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 317 days
castlerealestatemarketing.com tour.castlerealestatemarketing.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Mar 2023 88 days
higginbothamphotography.com tour.higginbothamphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2021 Jul 2022 314 days
benaccinelli.com tours.benaccinelli.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
curb360.com tours.curb360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Nov 2023 2 years, 320 days
realestatedronessd.com tours.realestatedronessd.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2022 1 year, 50 days
rmxexecutive.com tours.rmxexecutive.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Feb 2022 267 days
visualmediahd.com tours.visualmediahd.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Jan 2022 293 days
vogelcreative.ca tours.vogelcreative.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2021 Feb 2024 2 years, 210 days
veeshome.com veeshome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 181 days
talktopaul.com vip.talktopaul.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Jun 2021 153 days
suburbanlens.com websites.suburbanlens.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Jan 2022 295 days
casadirame.com casadirame.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 166 days
brubeckhouse.com brubeckhouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 138 days
casaonpennell.com casaonpennell.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Feb 2024 102 days
aw360.me my.aw360.me
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Feb 2024 296 days
captivateproductions.org client.captivateproductions.org
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Sep 2023 61 days
flashforward.photos client.flashforward.photos
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2021 Dec 2021 117 days
designerhomestyles.com designerhomestyles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Feb 2024 95 days
flaggdrive.com flaggdrive.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Jan 2021 One Off
glass7thfloor.com glass7thfloor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 109 days
harecreekterrace.com harecreekterrace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 61 days
historiccromwellestate.com historiccromwellestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Sep 2023 One Off
hometour.me hometour.me
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Nov 2023 2 years, 317 days
innerrichmondduplex.com innerrichmondduplex.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 24 days
karrstreet.com karrstreet.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Jul 2021 47 days
liamlatin.com liamlatin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 146 days
lincolnparklawnlust.com lincolnparklawnlust.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 88 days
danielbluephotography.com listings.danielbluephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2021 Dec 2021 306 days
elevatedlistingstx.com listings.elevatedlistingstx.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Jan 2024 285 days
focus-rep.com listings.focus-rep.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Oct 2023 81 days
greatbayphotography.com listings.greatbayphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Apr 2022 1 year, 110 days
ground2airmedia.com listings.ground2airmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2022 Jan 2024 1 year, 173 days
mattpiercephoto.com listings.mattpiercephoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Dec 2023 2 years, 194 days
nextdoorphotos.com listings.nextdoorphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Jan 2024 3 years, 23 days
panhandleproductions.net listings.panhandleproductions.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Nov 2021 305 days
photoreal.ca listings.photoreal.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2022 Feb 2024 1 year, 123 days
pixerpros.com listings.pixerpros.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Apr 2023 1 year, 193 days
relawldemo.com listings.relawldemo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 28 days
sitesforproperties.com listings.sitesforproperties.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Aug 2023 171 days
digenovamedia.ca login.digenovamedia.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2022 Nov 2022 One Off
dynamictours.ca login.dynamictours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2024 Feb 2024 51 days
focus-rep.com login.focus-rep.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 May 2023 One Off
goosemediagroup.com login.goosemediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2022 Feb 2024 1 year, 177 days
hrantmedia.com login.hrantmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2021 Aug 2023 1 year, 323 days
joshmeyerfilms.com login.joshmeyerfilms.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2023 Jun 2023 One Off
skyrealtymedia.com login.skyrealtymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2022 Jan 2023 252 days
revedio.com myrevedio.revedio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Feb 2024 1 year, 334 days
palmiahomeforsale.com palmiahomeforsale.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 18 days
laidlawphotography.com photos.laidlawphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Dec 2023 239 days
aremacphotography.com portal.aremacphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2022 Feb 2024 2 years, 26 days
lalush.com properties.lalush.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Dec 2023 2 years, 194 days
ranchesatsentinelpeaktract3.com ranchesatsentinelpeaktract3.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 54 days
ritzcarltonvilla810.com ritzcarltonvilla810.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 78 days
aresortwithinaresort.com aresortwithinaresort.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Jan 2023 2 years, 25 days
castrocondo.com castrocondo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 110 days
santafloritaave.com santafloritaave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2022 Sep 2022 207 days
photographervince.com agent.photographervince.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Nov 2023 One Off
360captures.com sites.360captures.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Dec 2021 346 days
artesiantitle.com sites.artesiantitle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2021 Oct 2023 2 years, 59 days
capturereality.io sites.capturereality.io
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Feb 2024 300 days
coremarketingconcepts.com sites.coremarketingconcepts.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 303 days
crossroadsrealtynj.com sites.crossroadsrealtynj.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2022 Jun 2023 345 days
dreamhomeimages.com sites.dreamhomeimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Feb 2024 2 years, 248 days
dreamhomemedia.com sites.dreamhomemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Nov 2021 307 days
elevatovisuals.com sites.elevatovisuals.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2021 Nov 2023 2 years, 83 days
febreframeworks.com sites.febreframeworks.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Jul 2022 1 year, 55 days
fullframecreativeagency.com sites.fullframecreativeagency.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2022 Feb 2024 2 years, 29 days
genesisvue.com sites.genesisvue.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2022 Feb 2024 1 year, 274 days
happyhousegta.com sites.happyhousegta.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Nov 2023 240 days
huntressmedia.com sites.huntressmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Apr 2022 38 days
jdmontero.com sites.jdmontero.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Sep 2023 2 years, 121 days
jmphilms.com sites.jmphilms.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2022 Feb 2024 1 year, 237 days
kianikanstudio.ca sites.kianikanstudio.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 125 days
liftecmedia.com sites.liftecmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2023 Feb 2024 246 days
listedphotos.com sites.listedphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2021 Jun 2022 1 year, 82 days
listvt.com sites.listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2021 Feb 2024 2 years, 349 days
lounny.com sites.lounny.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2021 Feb 2024 2 years, 235 days
mshaltout-realphotography.com sites.mshaltout-realphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2021 Aug 2023 2 years, 33 days
perfectviewstudios.com sites.perfectviewstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Jul 2022 278 days
realtoursswfl.com sites.realtoursswfl.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2021 Feb 2024 2 years, 88 days
reel2realestates.com sites.reel2realestates.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2022 Sep 2023 1 year, 106 days
richmountcreative.com sites.richmountcreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Feb 2024 1 year, 43 days
royaltystudios.co sites.royaltystudios.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2022 Feb 2024 1 year, 162 days
shutterlist.com sites.shutterlist.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Feb 2024 2 years, 269 days
slevinhurtado.com sites.slevinhurtado.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Feb 2024 114 days
snapairphoto.com sites.snapairphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 330 days
southbaypics.com sites.southbaypics.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2021 Feb 2024 2 years, 215 days
virtuahomes.com sites.virtuahomes.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2021 Apr 2022 116 days
virtualview360.com sites.virtualview360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2021 Feb 2024 2 years, 210 days
walters.photography sites.walters.photography
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Feb 2024 230 days
willventuresphoto.com sites.willventuresphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
skye30a.com skye30a.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Feb 2024 114 days
1077rankin.com 1077rankin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 164 days
10836northridge.com 10836northridge.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2021 38 days
12sweetbriarcirunit4.info 12sweetbriarcirunit4.info
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Mar 2022 149 days
13908hutchinsonplace.com 13908hutchinsonplace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Dec 2023 One Off
144lostrancos.com 144lostrancos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2021 38 days
150orleans510.com 150orleans510.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Sep 2023 One Off
stonecrestlaketahoe.com stonecrestlaketahoe.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
verticalmediatx.com agent.verticalmediatx.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 131 days
thehomeonvashon.com thehomeonvashon.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 123 days
themusehouse.com themusehouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 123 days
theoneinseattle.com theoneinseattle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 123 days
chadjonesphoto.com tour.chadjonesphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 303 days
digenovamedia.ca tour.digenovamedia.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Jan 2024 284 days
shutterhouse.ca tour.shutterhouse.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Feb 2024 363 days
realtoursswfl.com tours.realtoursswfl.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2021 Mar 2021 One Off
villacaballeros311.com villacaballeros311.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2021 32 days
augmentum.ca virtualtours.augmentum.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 181 days
westlacollection.com westlacollection.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2021 Aug 2021 One Off
brussels-st.com brussels-st.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2022 Sep 2023 301 days
28photos.com realestate.28photos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
topdownphotos.com my.topdownphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 17 days
784design.com client.784design.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Feb 2024 1 year, 32 days
benson-productions.com client.benson-productions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2021 Jan 2023 1 year, 170 days
crephotos.com client.crephotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 62 days
flashforwardwa.com client.flashforwardwa.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Sep 2022 170 days
redheiferproductions.com clientportal.redheiferproductions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 128 days
coastalhometours.com clients.coastalhometours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2021 May 2023 2 years, 70 days
coastalrealestatemedia.com clients.coastalrealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Feb 2024 225 days
flashitsold.com clients.flashitsold.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2021 Nov 2021 One Off
glass9thfloor.com glass9thfloor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 33 days
grandsummitranch.com grandsummitranch.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 46 days
teamcirca.com homes.teamcirca.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Feb 2024 312 days
imperialhousephb.com imperialhousephb.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 30 days
relaace.com relaace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2021 Mar 2021 One Off
spectrumrealestatephotography.com remaxadvance.spectrumrealestatephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Feb 2024 2 years, 115 days
acreagehomeinredmond.com acreagehomeinredmond.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Dec 2023 111 days
seaoaksvero.com seaoaksvero.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Jun 2022 1 year, 161 days
seasidesandsinnmotel.com seasidesandsinnmotel.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 130 days
aimagery.com site.aimagery.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 318 days
aeriousplus.com sites.aeriousplus.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2022 Feb 2024 2 years, 28 days
brownbear-productions.com sites.brownbear-productions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 May 2023 2 years, 10 days
calrealestatemedia.com sites.calrealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2022 Feb 2024 1 year, 244 days
craigbernardi.com sites.craigbernardi.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
curbviews.com sites.curbviews.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Feb 2024 296 days
davewarren.net sites.davewarren.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2022 Sep 2023 288 days
digitalhometours.ca sites.digitalhometours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 135 days
discovervirtual360.com sites.discovervirtual360.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
dronehomemedia.com sites.dronehomemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 53 days
dustinclyde.com sites.dustinclyde.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
housepics4u.ca sites.housepics4u.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2022 Feb 2024 1 year, 134 days
ictimaging.com sites.ictimaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 167 days
inhabitphotography.com sites.inhabitphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2022 Feb 2024 2 years, 15 days
intextphotography.com sites.intextphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Feb 2024 2 years, 287 days
itsrealestatepropertyservices.com sites.itsrealestatepropertyservices.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Jan 2024 289 days
keesnap.com sites.keesnap.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 39 days
megmediagroup.com sites.megmediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Feb 2024 1 year, 49 days
nausetmedia.com sites.nausetmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Feb 2024 2 years, 277 days
njpropertypix.com sites.njpropertypix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 37 days
ospreymediaalliance.com sites.ospreymediaalliance.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Apr 2023 One Off
pantheraaerial.com sites.pantheraaerial.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2023 Feb 2024 1 year, 2 days
pdxdan.com sites.pdxdan.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2021 Jan 2024 2 years, 62 days
porticomedia.net sites.porticomedia.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Feb 2024 2 years, 146 days
primeremedia.net sites.primeremedia.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2021 Feb 2024 2 years, 89 days
radiantphotovideo.com sites.radiantphotovideo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Feb 2024 317 days
refleximaging.com sites.refleximaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2022 Feb 2024 1 year, 121 days
seattleprophotography.com sites.seattleprophotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2021 Feb 2024 2 years, 226 days
sfvt.us sites.sfvt.us
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Apr 2023 128 days
shadowpointmedia.com sites.shadowpointmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Feb 2024 363 days
showingaustin.com sites.showingaustin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Feb 2024 292 days
staceyhennessy.com sites.staceyhennessy.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 330 days
swaffordimaging.com sites.swaffordimaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2022 Jul 2022 25 days
trifectamediasd.com sites.trifectamediasd.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2022 Nov 2023 1 year, 217 days
virtourmedia.com sites.virtourmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Feb 2024 2 years, 129 days
virtualviewtours.com sites.virtualviewtours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2022 Mar 2023 239 days
youngrealtymedia.com sites.youngrealtymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 66 days
avegbythesea.com avegbythesea.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 140 days
10021686west13avenue.com 10021686west13avenue.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 33 days
103fairviewchurch.com 103fairviewchurch.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 12 days
106-bixby-hill.com 106-bixby-hill.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 62 days
1105georgina.com 1105georgina.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Apr 2021 99 days
120wcatherine.com 120wcatherine.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Mar 2022 149 days
123relastreet.com 123relastreet.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 May 2022 1 year, 133 days
123stakdrive.com 123stakdrive.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2022 Aug 2022 220 days
129turnberryway.com 129turnberryway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 33 days
12jacquelineroadunitc.com 12jacquelineroadunitc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Dec 2023 112 days
1500third.com 1500third.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Jul 2022 262 days
1507mefferdave.com 1507mefferdave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 70 days
topfloorhome.com topfloorhome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2021 Feb 2021 One Off
bcpoverlook.com bcpoverlook.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Jun 2023 2 years, 159 days
amazinglistingphotos.com tour.amazinglistingphotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 69 days
virtualrevolutionllc.com tour.virtualrevolutionllc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2021 Feb 2024 3 years, 22 days
fullframehometours.com tours.fullframehometours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2022 1 year, 36 days
zipp3d.com tours.zipp3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 321 days
bigtamview.com bigtamview.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 139 days
vannnoord.com vannnoord.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 146 days
villahermosa12.com villahermosa12.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2021 32 days
luxoriginal.com virtualtours.luxoriginal.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Oct 2023 164 days
tagmi.ca visite.tagmi.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Jan 2022 100 days
toddsfotos.com vtours.toddsfotos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 328 days
igm-realestate.com booking.igm-realestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Feb 2024 91 days
arborvisualmedia.com websites.arborvisualmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2022 Feb 2024 1 year, 147 days
buybuchanen.com buybuchanen.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 111 days
canariasdoral4439nw81ave.com canariasdoral4439nw81ave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Nov 2023 65 days
victoriarealestatemarketing.tv s.victoriarealestatemarketing.tv
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
fullframehometours.com client.fullframehometours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2022 Feb 2024 1 year, 311 days
huscp.com client.huscp.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Feb 2024 331 days
seancarrie.com client.seancarrie.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Feb 2024 363 days
moorestudios.com clients.moorestudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 121 days
edinaluxuryhome.com edinaluxuryhome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 May 2021 120 days
csraaugustahomes.com forsale.csraaugustahomes.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2022 Oct 2022 42 days
goldcanyonazland.com goldcanyonazland.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Oct 2023 24 days
grandlakevilla.com grandlakevilla.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 154 days
greenfielddr.com greenfielddr.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 154 days
venturesir.com home.venturesir.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 325 days
dallaspro.com homes.dallaspro.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2022 Feb 2024 1 year, 316 days
primariusmedia.com homes.primariusmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Aug 2022 1 year, 212 days
aftertecai.com hostedby.aftertecai.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Feb 2024 2 years, 122 days
imperialhousepha.com imperialhousepha.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Jan 2024 30 days
lakeforestparkmidcenturygem.com lakeforestparkmidcenturygem.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 88 days
letitacrest.com letitacrest.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Dec 2023 87 days
mhv.co listedhq.mhv.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2022 Feb 2024 1 year, 301 days
im3rdmedia.com listing.im3rdmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2022 Feb 2024 1 year, 238 days
invznmedia.com listing.invznmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Feb 2024 1 year, 344 days
listing.pics listing.pics
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2023 Aug 2023 57 days
vexworks.com listing.vexworks.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Jan 2022 294 days
listing4.com listing4.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2021 Feb 2024 2 years, 349 days
alleganymedia.com listings.alleganymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Nov 2023 2 years, 315 days
allieweaverinteriors.com listings.allieweaverinteriors.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Nov 2023 2 years, 214 days
demophotog.com listings.demophotog.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 Feb 2024 298 days
denpg.com listings.denpg.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2021 Feb 2024 3 years, 2 days
dfwvt.com listings.dfwvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Feb 2024 2 years, 301 days
framexstudio.com listings.framexstudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Feb 2024 1 year, 57 days
gregsilvaphotography.com listings.gregsilvaphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 May 2023 1 year, 314 days
moatsteam.com listings.moatsteam.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Sep 2022 171 days
paidtogether.com listings.paidtogether.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
revolrealestate.com listings.revolrealestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Feb 2024 317 days
splicerealty.com listings.splicerealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 One Off
listvtace.com listvtace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Mar 2021 70 days
austynmoreno.com login.austynmoreno.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Aug 2022 1 year, 228 days
creativeinitiativeatl.com login.creativeinitiativeatl.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2022 Dec 2022 181 days
jfarrismedia.com login.jfarrismedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2024 Feb 2024 40 days
swetnammedia.com login.swetnammedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2023 May 2023 One Off
russlyon.com lux.russlyon.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Nov 2023 291 days
lwdreamhome.com lwdreamhome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Jan 2024 106 days
brixe.com marketing.brixe.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Dec 2021 351 days
propermeasure.com media.propermeasure.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2021 Feb 2024 2 years, 337 days
movingyouintherightdirection.com movingyouintherightdirection.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 141 days
orion3d.studio myspaceport.orion3d.studio
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Feb 2024 2 years, 274 days
nurmiisles.com nurmiisles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 157 days
theonemoregroup.com omg.theonemoregroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2022 Jul 2022 61 days
ricoretreat.com ricoretreat.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 25 days
penthouse4102.com penthouse4102.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Jul 2021 165 days
plantationpoimtsouth.com plantationpoimtsouth.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 135 days
impression1photography.com portal.impression1photography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Jan 2022 235 days
johnruzphoto.com portal.johnruzphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Feb 2024 90 days
local-shot.com portal.local-shot.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2022 Feb 2024 1 year, 267 days
ryanhalseyphotography.com properties.ryanhalseyphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2021 Jul 2023 1 year, 354 days
brookfieldphotographer.com property.brookfieldphotographer.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
corvusphotography.com propertysites.corvusphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Dec 2021 355 days
relahq.com relahq.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
thedowntowncreative.com request.thedowntowncreative.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2022 Feb 2024 1 year, 201 days
3eyemedia.com sites.3eyemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2021 Feb 2024 2 years, 204 days
5dgmedia.com sites.5dgmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Dec 2023 119 days
acreagency.com sites.acreagency.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2022 Nov 2023 1 year, 144 days
architaraphoto.com sites.architaraphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Feb 2024 2 years, 257 days
azimagepros.com sites.azimagepros.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2022 1 year, 28 days
beesknees-photography.com sites.beesknees-photography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 59 days
cathykoop.ca sites.cathykoop.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 4 days
csrarealestatephoto.com sites.csrarealestatephoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Sep 2023 2 years, 126 days
dakotacarroll.com sites.dakotacarroll.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2022 Jun 2022 One Off
domusvisions.com sites.domusvisions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Dec 2022 1 year, 240 days
dynamictours.ca sites.dynamictours.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2022 Sep 2023 1 year, 141 days
eastbayrealestatevideos.com sites.eastbayrealestatevideos.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Feb 2024 1 year, 350 days
elevotix.com sites.elevotix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2023 Feb 2024 96 days
explorify3d.com sites.explorify3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
flylisted.com sites.flylisted.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Feb 2024 212 days
hangtime27.com sites.hangtime27.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2023 Feb 2024 252 days
harmonps.com sites.harmonps.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2021 Feb 2024 2 years, 106 days
home-views.com sites.home-views.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
homejab.com sites.homejab.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2023 Feb 2024 184 days
i3dtours.com sites.i3dtours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
klikarts.com sites.klikarts.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Mar 2021 69 days
limestmedia.com sites.limestmedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2021 Jan 2024 2 years, 120 days
listing-standard.com sites.listing-standard.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2022 Feb 2024 1 year, 212 days
lux-pics.com sites.lux-pics.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2021 Feb 2022 144 days
mccourtneyphotographics.com sites.mccourtneyphotographics.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Feb 2024 1 year, 340 days
oneshotprods.com sites.oneshotprods.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
pdxrealestatetours.com sites.pdxrealestatetours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2022 Feb 2024 1 year, 262 days
precipitousimaging.com sites.precipitousimaging.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Feb 2024 80 days
property-pix.com sites.property-pix.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2021 Feb 2022 223 days
quickcloselistings.com sites.quickcloselistings.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
realestatemarketing-services.com sites.realestatemarketing-services.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Jan 2023 One Off
realpatience.com sites.realpatience.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 28 days
scatterscape.com sites.scatterscape.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2021 Feb 2024 2 years, 86 days
skyshotstudios.com sites.skyshotstudios.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2022 Feb 2024 1 year, 160 days
solpix.co sites.solpix.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2021 Feb 2024 3 years, 26 days
sparksmediagroup.com sites.sparksmediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2021 Feb 2024 2 years, 214 days
tcvtours3d.com sites.tcvtours3d.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2021 Feb 2024 2 years, 266 days
trueonegroup.com sites.trueonegroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2022 Feb 2024 1 year, 328 days
trueperceptionimages.com sites.trueperceptionimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2022 Feb 2024 1 year, 74 days
vantagemediaproductions.com sites.vantagemediaproductions.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 One Off
visionnj.com sites.visionnj.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 39 days
assemblyliving.com assemblyliving.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
100kentplaceblvd.com 100kentplaceblvd.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Mar 2022 130 days
10979chalonroad.net 10979chalonroad.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 176 days
1234address.com 1234address.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2023 Feb 2024 176 days
123northave.com 123northave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Mar 2022 1 year, 79 days
lunghimediagroup.com templates.lunghimediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
genevirtualtours.com tour.genevirtualtours.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2021 Feb 2022 90 days
higginbothammedia.com tour.higginbothammedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2022 May 2023 248 days
seacoastrephotography.com tour.seacoastrephotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 27 days
amazingphotovideo.com tours.amazingphotovideo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Nov 2023 2 years, 214 days
blueoceanmiami.com tours.blueoceanmiami.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 312 days
caldecott.com tours.caldecott.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Jan 2023 1 year, 289 days
dronetoursllc.com tours.dronetoursllc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Feb 2024 336 days
justaskjask.com tours.justaskjask.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
newvisionstudio.com tours.newvisionstudio.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
photoconnor.com tours.photoconnor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
riptidemedia.net tours.riptidemedia.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 May 2022 212 days
srq360media.com tours.srq360media.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
vrsquadinc.com tours.vrsquadinc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
vividvm.com user.vividvm.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2023 Feb 2024 339 days
c21colonial.ca virtualtour.c21colonial.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2021 Jan 2024 2 years, 61 days
westgissingroad.com westgissingroad.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 145 days
virtualdreamspaces.com your.virtualdreamspaces.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Oct 2021 One Off
zibicondo.com zibicondo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2021 36 days
listvt.com u.listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 34 days
goproptech.com client.goproptech.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2023 Feb 2023 One Off
cre8r.agency clients.cre8r.agency
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Feb 2024 Feb 2024 2 days
jackvatcherphotography.com clients.jackvatcherphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Jan 2024 3 years, 13 days
thehomebird.com clients.thehomebird.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Jan 2022 1 year, 21 days
comehome.to comehome.to
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Apr 2022 1 year, 93 days
daxcourt.com daxcourt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 May 2021 118 days
islandsothebysrealty.com featured.islandsothebysrealty.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
btwimages.com homes.btwimages.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Feb 2024 2 years, 321 days
ejp.photo homes.ejp.photo
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Feb 2024 1 year, 350 days
motioncitymedia.com homes.motioncitymedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
thecornerstoneteam.com homes.thecornerstoneteam.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2021 Jun 2022 243 days
irownwoodcrossingqc.com irownwoodcrossingqc.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2023 Dec 2023 One Off
kensingtontic.com kensingtontic.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Feb 2024 148 days
listedhq.com listedhq.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Feb 2024 1 year, 341 days
growthehive.com listing.growthehive.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2021 Apr 2023 1 year, 139 days
hiverealestatemedia.com listing.hiverealestatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jun 2023 Feb 2024 252 days
morrisonteam.com listing.morrisonteam.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ May 2021 Feb 2024 2 years, 278 days
trevisuality.com listing.trevisuality.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2022 Feb 2024 1 year, 155 days
bokomedia.com listings.bokomedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2023 Oct 2023 82 days
homevideorealestate.com listings.homevideorealestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2022 Nov 2023 1 year, 83 days
mhv.co listings.mhv.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2021 Sep 2021 One Off
picpros.ca listings.picpros.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
sevenimages.co listings.sevenimages.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Jan 2022 1 year, 16 days
zuwerksphotography.com listings.zuwerksphotography.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
listvt.com listvt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 34 days
aimmedia.group login.aimmedia.group
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2023 Feb 2024 1 year, 31 days
treefort-media.com login.treefort-media.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Mar 2022 Feb 2024 1 year, 363 days
lwhometour.com lwhometour.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Jan 2021 20 days
lwopenhouse.com lwopenhouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024 3 years, 54 days
the3rdeye.ca mysite.the3rdeye.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2023 Apr 2023 One Off
oldesouthva.com oldesouthva.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2023 Oct 2023 19 days
virtualviewing.ca portal.virtualviewing.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Jan 2022 294 days
lystpros.com preview.lystpros.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2021 Sep 2022 293 days
360estatemedia.com properties.360estatemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2021 Apr 2022 245 days
bolorphoto.com properties.bolorphoto.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Aug 2021 Feb 2022 171 days
scherbamedia.com properties.scherbamedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jul 2022 Feb 2024 1 year, 231 days
wheelerhomeconcepts.com realestate.wheelerhomeconcepts.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Apr 2021 Jan 2022 292 days
SITES.DISCOVERAERIAL.COM
Non IP Attributes
Attribute First Last
IC IC-ZN9P6ZWJ Jan 2021 Feb 2024
SITES.DISCOVERAERIAL.COM
Overlap Attribute Domains
listing.fdimedia.com listing.fdimedia.com
listing.otbxair.com listing.otbxair.com
listings.aerialcanvas.com listings.aerialcanvas.com
listings.axtonandliv.com listings.axtonandliv.com
listings.docprops.com listings.docprops.com
listings.grmedia.ca listings.grmedia.ca
listings.realtyexecutivesbw.com listings.realtyexecutivesbw.com
listings.snapsharks.com listings.snapsharks.com
listings.thergbstudios.com listings.thergbstudios.com
listings.vastmediaspace.com listings.vastmediaspace.com
listings.westrobin.com listings.westrobin.com
live.aperturemedia.io live.aperturemedia.io
live.kuperrealty.com live.kuperrealty.com
login.motownproductions.com login.motownproductions.com
luxehomestyles.com luxehomestyles.com
lwvhome.com lwvhome.com
madrone118.com madrone118.com
media.cincyvisuals.com media.cincyvisuals.com
media.homesellerstudio.com media.homesellerstudio.com
media.openhouse360.com media.openhouse360.com
media.remco.solutions media.remco.solutions
mylisting.estatephotos.la mylisting.estatephotos.la
myspaceport.orion3dstudios.com myspaceport.orion3dstudios.com
ranchobuenavidatexas.com ranchobuenavidatexas.com
pages.richlonardo.com pages.richlonardo.com
palmiahomesforsale.com palmiahomesforsale.com
photos.lresmarketing.com photos.lresmarketing.com
portfolio.scrug.gs portfolio.scrug.gs
properties.aspectvisuals.co properties.aspectvisuals.co
properties.kcrealtymedia.com properties.kcrealtymedia.com
properties.lumifulmedia.com properties.lumifulmedia.com
properties.shftgroup.ca properties.shftgroup.ca
properties.spectrumrealestatephotography.com properties.spectrumrealestatephotography.com
remedia.jdpworks.com remedia.jdpworks.com
rent1313sealway.com rent1313sealway.com
scenicdriveestate.com scenicdriveestate.com
seasidepearlfarmgatewinery.info seasidepearlfarmgatewinery.info
sites.adioimages.com sites.adioimages.com
sites.agent4m.com sites.agent4m.com
sites.allmediatours.com sites.allmediatours.com
sites.ardentmediagroup.ca sites.ardentmediagroup.ca
sites.austinlistingphotos.com sites.austinlistingphotos.com
sites.bluebruinphotography.com sites.bluebruinphotography.com
sites.brookroadphotography.com sites.brookroadphotography.com
sites.changeovermedia.com sites.changeovermedia.com
sites.craigsauer3d.com sites.craigsauer3d.com
sites.discoveraerial.com sites.discoveraerial.com
sites.elevatedphotos.ca sites.elevatedphotos.ca
sites.elite360tours.com sites.elite360tours.com
sites.firelightimages.com sites.firelightimages.com
sites.flywithsas.com sites.flywithsas.com
sites.fullbarsmedia.com sites.fullbarsmedia.com
sites.gestaltgroup.com sites.gestaltgroup.com
sites.helicopix.com sites.helicopix.com
sites.highfivemediapro.com sites.highfivemediapro.com
sites.homelaunch.ca sites.homelaunch.ca
sites.jpmrealestatephotography.com sites.jpmrealestatephotography.com
sites.lunghistudio.com sites.lunghistudio.com
sites.matthewjamesphoto.ca sites.matthewjamesphoto.ca
sites.monarch-hd.com sites.monarch-hd.com
sites.odyssey3d.ca sites.odyssey3d.ca
sites.radiusmediacompany.com sites.radiusmediacompany.com
sites.realtronaccelerate.ca sites.realtronaccelerate.ca
sites.redluxury.com sites.redluxury.com
sites.relahqdemo.com sites.relahqdemo.com
sites.ruummedia.com sites.ruummedia.com
sites.siliconvalleyphotos.com sites.siliconvalleyphotos.com
sites.sjvirtualtours.ca sites.sjvirtualtours.ca
sites.taftpix.com sites.taftpix.com
sites.taylorallancreative.com sites.taylorallancreative.com
sites.tracycolburn.com sites.tracycolburn.com
sites.uniquemediadesign.com sites.uniquemediadesign.com
sites.visualistmedia.com sites.visualistmedia.com
sites.wtcreative.com sites.wtcreative.com
sites.wymangentry.com sites.wymangentry.com
104mirasolct.com 104mirasolct.com
123iconstreet.com 123iconstreet.com
145robbyln.com 145robbyln.com
stonewellcourt.com stonewellcourt.com
theoutpostestate.com theoutpostestate.com
tour.api360.ca tour.api360.ca
tour.castlerealestatemarketing.com tour.castlerealestatemarketing.com
tour.higginbothamphotography.com tour.higginbothamphotography.com
tours.benaccinelli.com tours.benaccinelli.com
tours.curb360.com tours.curb360.com
tours.realestatedronessd.com tours.realestatedronessd.com
tours.rmxexecutive.com tours.rmxexecutive.com
tours.visualmediahd.com tours.visualmediahd.com
tours.vogelcreative.ca tours.vogelcreative.ca
veeshome.com veeshome.com
vip.talktopaul.com vip.talktopaul.com
websites.suburbanlens.com websites.suburbanlens.com
casadirame.com casadirame.com
brubeckhouse.com brubeckhouse.com
casaonpennell.com casaonpennell.com
my.aw360.me my.aw360.me
client.captivateproductions.org client.captivateproductions.org
client.flashforward.photos client.flashforward.photos
designerhomestyles.com designerhomestyles.com
flaggdrive.com flaggdrive.com
glass7thfloor.com glass7thfloor.com
harecreekterrace.com harecreekterrace.com
historiccromwellestate.com historiccromwellestate.com
hometour.me hometour.me
innerrichmondduplex.com innerrichmondduplex.com
karrstreet.com karrstreet.com
liamlatin.com liamlatin.com
lincolnparklawnlust.com lincolnparklawnlust.com
listings.danielbluephotography.com listings.danielbluephotography.com
listings.elevatedlistingstx.com listings.elevatedlistingstx.com
listings.focus-rep.com listings.focus-rep.com
listings.greatbayphotography.com listings.greatbayphotography.com
listings.ground2airmedia.com listings.ground2airmedia.com
listings.mattpiercephoto.com listings.mattpiercephoto.com
listings.nextdoorphotos.com listings.nextdoorphotos.com
listings.panhandleproductions.net listings.panhandleproductions.net
listings.photoreal.ca listings.photoreal.ca
listings.pixerpros.com listings.pixerpros.com
listings.relawldemo.com listings.relawldemo.com
listings.sitesforproperties.com listings.sitesforproperties.com
login.digenovamedia.ca login.digenovamedia.ca
login.dynamictours.ca login.dynamictours.ca
login.focus-rep.com login.focus-rep.com
login.goosemediagroup.com login.goosemediagroup.com
login.hrantmedia.com login.hrantmedia.com
login.joshmeyerfilms.com login.joshmeyerfilms.com
login.skyrealtymedia.com login.skyrealtymedia.com
myrevedio.revedio.com myrevedio.revedio.com
palmiahomeforsale.com palmiahomeforsale.com
photos.laidlawphotography.com photos.laidlawphotography.com
portal.aremacphotography.com portal.aremacphotography.com
properties.lalush.com properties.lalush.com
ranchesatsentinelpeaktract3.com ranchesatsentinelpeaktract3.com
ritzcarltonvilla810.com ritzcarltonvilla810.com
aresortwithinaresort.com aresortwithinaresort.com
castrocondo.com castrocondo.com
santafloritaave.com santafloritaave.com
agent.photographervince.com agent.photographervince.com
sites.360captures.com sites.360captures.com
sites.artesiantitle.com sites.artesiantitle.com
sites.capturereality.io sites.capturereality.io
sites.coremarketingconcepts.com sites.coremarketingconcepts.com
sites.crossroadsrealtynj.com sites.crossroadsrealtynj.com
sites.dreamhomeimages.com sites.dreamhomeimages.com
sites.dreamhomemedia.com sites.dreamhomemedia.com
sites.elevatovisuals.com sites.elevatovisuals.com
sites.febreframeworks.com sites.febreframeworks.com
sites.fullframecreativeagency.com sites.fullframecreativeagency.com
sites.genesisvue.com sites.genesisvue.com
sites.happyhousegta.com sites.happyhousegta.com
sites.huntressmedia.com sites.huntressmedia.com
sites.jdmontero.com sites.jdmontero.com
sites.jmphilms.com sites.jmphilms.com
sites.kianikanstudio.ca sites.kianikanstudio.ca
sites.liftecmedia.com sites.liftecmedia.com
sites.listedphotos.com sites.listedphotos.com
sites.listvt.com sites.listvt.com
sites.lounny.com sites.lounny.com
sites.mshaltout-realphotography.com sites.mshaltout-realphotography.com
sites.perfectviewstudios.com sites.perfectviewstudios.com
sites.realtoursswfl.com sites.realtoursswfl.com
sites.reel2realestates.com sites.reel2realestates.com
sites.richmountcreative.com sites.richmountcreative.com
sites.royaltystudios.co sites.royaltystudios.co
sites.shutterlist.com sites.shutterlist.com
sites.slevinhurtado.com sites.slevinhurtado.com
sites.snapairphoto.com sites.snapairphoto.com
sites.southbaypics.com sites.southbaypics.com
sites.virtuahomes.com sites.virtuahomes.com
sites.virtualview360.com sites.virtualview360.com
sites.walters.photography sites.walters.photography
sites.willventuresphoto.com sites.willventuresphoto.com
skye30a.com skye30a.com
1077rankin.com 1077rankin.com
10836northridge.com 10836northridge.com
12sweetbriarcirunit4.info 12sweetbriarcirunit4.info
13908hutchinsonplace.com 13908hutchinsonplace.com
144lostrancos.com 144lostrancos.com
150orleans510.com 150orleans510.com
stonecrestlaketahoe.com stonecrestlaketahoe.com
agent.verticalmediatx.com agent.verticalmediatx.com
thehomeonvashon.com thehomeonvashon.com
themusehouse.com themusehouse.com
theoneinseattle.com theoneinseattle.com
tour.chadjonesphoto.com tour.chadjonesphoto.com
tour.digenovamedia.ca tour.digenovamedia.ca
tour.shutterhouse.ca tour.shutterhouse.ca
tours.realtoursswfl.com tours.realtoursswfl.com
villacaballeros311.com villacaballeros311.com
virtualtours.augmentum.ca virtualtours.augmentum.ca
westlacollection.com westlacollection.com
brussels-st.com brussels-st.com
realestate.28photos.com realestate.28photos.com
my.topdownphotos.com my.topdownphotos.com
client.784design.com client.784design.com
client.benson-productions.com client.benson-productions.com
client.crephotos.com client.crephotos.com
client.flashforwardwa.com client.flashforwardwa.com
clientportal.redheiferproductions.com clientportal.redheiferproductions.com
clients.coastalhometours.com clients.coastalhometours.com
clients.coastalrealestatemedia.com clients.coastalrealestatemedia.com
clients.flashitsold.com clients.flashitsold.com
glass9thfloor.com glass9thfloor.com
grandsummitranch.com grandsummitranch.com
homes.teamcirca.com homes.teamcirca.com
imperialhousephb.com imperialhousephb.com
relaace.com relaace.com
remaxadvance.spectrumrealestatephotography.com remaxadvance.spectrumrealestatephotography.com
acreagehomeinredmond.com acreagehomeinredmond.com
seaoaksvero.com seaoaksvero.com
seasidesandsinnmotel.com seasidesandsinnmotel.com
site.aimagery.com site.aimagery.com
sites.aeriousplus.com sites.aeriousplus.com
sites.brownbear-productions.com sites.brownbear-productions.com
sites.calrealestatemedia.com sites.calrealestatemedia.com
sites.craigbernardi.com sites.craigbernardi.com
sites.curbviews.com sites.curbviews.com
sites.davewarren.net sites.davewarren.net
sites.digitalhometours.ca sites.digitalhometours.ca
sites.discovervirtual360.com sites.discovervirtual360.com
sites.dronehomemedia.com sites.dronehomemedia.com
sites.dustinclyde.com sites.dustinclyde.com
sites.housepics4u.ca sites.housepics4u.ca
sites.ictimaging.com sites.ictimaging.com
sites.inhabitphotography.com sites.inhabitphotography.com
sites.intextphotography.com sites.intextphotography.com
sites.itsrealestatepropertyservices.com sites.itsrealestatepropertyservices.com
sites.keesnap.com sites.keesnap.com
sites.megmediagroup.com sites.megmediagroup.com
sites.nausetmedia.com sites.nausetmedia.com
sites.njpropertypix.com sites.njpropertypix.com
sites.ospreymediaalliance.com sites.ospreymediaalliance.com
sites.pantheraaerial.com sites.pantheraaerial.com
sites.pdxdan.com sites.pdxdan.com
sites.porticomedia.net sites.porticomedia.net
sites.primeremedia.net sites.primeremedia.net
sites.radiantphotovideo.com sites.radiantphotovideo.com
sites.refleximaging.com sites.refleximaging.com
sites.seattleprophotography.com sites.seattleprophotography.com
sites.sfvt.us sites.sfvt.us
sites.shadowpointmedia.com sites.shadowpointmedia.com
sites.showingaustin.com sites.showingaustin.com
sites.staceyhennessy.com sites.staceyhennessy.com
sites.swaffordimaging.com sites.swaffordimaging.com
sites.trifectamediasd.com sites.trifectamediasd.com
sites.virtourmedia.com sites.virtourmedia.com
sites.virtualviewtours.com sites.virtualviewtours.com
sites.youngrealtymedia.com sites.youngrealtymedia.com
avegbythesea.com avegbythesea.com
10021686west13avenue.com 10021686west13avenue.com
103fairviewchurch.com 103fairviewchurch.com
106-bixby-hill.com 106-bixby-hill.com
1105georgina.com 1105georgina.com
120wcatherine.com 120wcatherine.com
123relastreet.com 123relastreet.com
123stakdrive.com 123stakdrive.com
129turnberryway.com 129turnberryway.com
12jacquelineroadunitc.com 12jacquelineroadunitc.com
1500third.com 1500third.com
1507mefferdave.com 1507mefferdave.com
topfloorhome.com topfloorhome.com
bcpoverlook.com bcpoverlook.com
tour.amazinglistingphotos.com tour.amazinglistingphotos.com
tour.virtualrevolutionllc.com tour.virtualrevolutionllc.com
tours.fullframehometours.com tours.fullframehometours.com
tours.zipp3d.com tours.zipp3d.com
bigtamview.com bigtamview.com
vannnoord.com vannnoord.com
villahermosa12.com villahermosa12.com
virtualtours.luxoriginal.com virtualtours.luxoriginal.com
visite.tagmi.ca visite.tagmi.ca
vtours.toddsfotos.com vtours.toddsfotos.com
booking.igm-realestate.com booking.igm-realestate.com
websites.arborvisualmedia.com websites.arborvisualmedia.com
buybuchanen.com buybuchanen.com
canariasdoral4439nw81ave.com canariasdoral4439nw81ave.com
s.victoriarealestatemarketing.tv s.victoriarealestatemarketing.tv
client.fullframehometours.com client.fullframehometours.com
client.huscp.com client.huscp.com
client.seancarrie.com client.seancarrie.com
clients.moorestudios.com clients.moorestudios.com
edinaluxuryhome.com edinaluxuryhome.com
forsale.csraaugustahomes.com forsale.csraaugustahomes.com
goldcanyonazland.com goldcanyonazland.com
grandlakevilla.com grandlakevilla.com
greenfielddr.com greenfielddr.com
home.venturesir.com home.venturesir.com
homes.dallaspro.com homes.dallaspro.com
homes.primariusmedia.com homes.primariusmedia.com
hostedby.aftertecai.com hostedby.aftertecai.com
imperialhousepha.com imperialhousepha.com
lakeforestparkmidcenturygem.com lakeforestparkmidcenturygem.com
letitacrest.com letitacrest.com
listedhq.mhv.co listedhq.mhv.co
listing.im3rdmedia.com listing.im3rdmedia.com
listing.invznmedia.com listing.invznmedia.com
listing.pics listing.pics
listing.vexworks.com listing.vexworks.com
listing4.com listing4.com
listings.alleganymedia.com listings.alleganymedia.com
listings.allieweaverinteriors.com listings.allieweaverinteriors.com
listings.demophotog.com listings.demophotog.com
listings.denpg.com listings.denpg.com
listings.dfwvt.com listings.dfwvt.com
listings.framexstudio.com listings.framexstudio.com
listings.gregsilvaphotography.com listings.gregsilvaphotography.com
listings.moatsteam.com listings.moatsteam.com
listings.paidtogether.com listings.paidtogether.com
listings.revolrealestate.com listings.revolrealestate.com
listings.splicerealty.com listings.splicerealty.com
listvtace.com listvtace.com
login.austynmoreno.com login.austynmoreno.com
login.creativeinitiativeatl.com login.creativeinitiativeatl.com
login.jfarrismedia.com login.jfarrismedia.com
login.swetnammedia.com login.swetnammedia.com
lux.russlyon.com lux.russlyon.com
lwdreamhome.com lwdreamhome.com
marketing.brixe.com marketing.brixe.com
media.propermeasure.com media.propermeasure.com
movingyouintherightdirection.com movingyouintherightdirection.com
myspaceport.orion3d.studio myspaceport.orion3d.studio
nurmiisles.com nurmiisles.com
omg.theonemoregroup.com omg.theonemoregroup.com
ricoretreat.com ricoretreat.com
penthouse4102.com penthouse4102.com
plantationpoimtsouth.com plantationpoimtsouth.com
portal.impression1photography.com portal.impression1photography.com
portal.johnruzphoto.com portal.johnruzphoto.com
portal.local-shot.com portal.local-shot.com
properties.ryanhalseyphotography.com properties.ryanhalseyphotography.com
property.brookfieldphotographer.com property.brookfieldphotographer.com
propertysites.corvusphotography.com propertysites.corvusphotography.com
relahq.com relahq.com
request.thedowntowncreative.com request.thedowntowncreative.com
sites.3eyemedia.com sites.3eyemedia.com
sites.5dgmedia.com sites.5dgmedia.com
sites.acreagency.com sites.acreagency.com
sites.architaraphoto.com sites.architaraphoto.com
sites.azimagepros.com sites.azimagepros.com
sites.beesknees-photography.com sites.beesknees-photography.com
sites.cathykoop.ca sites.cathykoop.ca
sites.csrarealestatephoto.com sites.csrarealestatephoto.com
sites.dakotacarroll.com sites.dakotacarroll.com
sites.domusvisions.com sites.domusvisions.com
sites.dynamictours.ca sites.dynamictours.ca
sites.eastbayrealestatevideos.com sites.eastbayrealestatevideos.com
sites.elevotix.com sites.elevotix.com
sites.explorify3d.com sites.explorify3d.com
sites.flylisted.com sites.flylisted.com
sites.hangtime27.com sites.hangtime27.com
sites.harmonps.com sites.harmonps.com
sites.home-views.com sites.home-views.com
sites.homejab.com sites.homejab.com
sites.i3dtours.com sites.i3dtours.com
sites.klikarts.com sites.klikarts.com
sites.limestmedia.com sites.limestmedia.com
sites.listing-standard.com sites.listing-standard.com
sites.lux-pics.com sites.lux-pics.com
sites.mccourtneyphotographics.com sites.mccourtneyphotographics.com
sites.oneshotprods.com sites.oneshotprods.com
sites.pdxrealestatetours.com sites.pdxrealestatetours.com
sites.precipitousimaging.com sites.precipitousimaging.com
sites.property-pix.com sites.property-pix.com
sites.quickcloselistings.com sites.quickcloselistings.com
sites.realestatemarketing-services.com sites.realestatemarketing-services.com
sites.realpatience.com sites.realpatience.com
sites.scatterscape.com sites.scatterscape.com
sites.skyshotstudios.com sites.skyshotstudios.com
sites.solpix.co sites.solpix.co
sites.sparksmediagroup.com sites.sparksmediagroup.com
sites.tcvtours3d.com sites.tcvtours3d.com
sites.trueonegroup.com sites.trueonegroup.com
sites.trueperceptionimages.com sites.trueperceptionimages.com
sites.vantagemediaproductions.com sites.vantagemediaproductions.com
sites.visionnj.com sites.visionnj.com
assemblyliving.com assemblyliving.com
100kentplaceblvd.com 100kentplaceblvd.com
10979chalonroad.net 10979chalonroad.net
1234address.com 1234address.com
123northave.com 123northave.com
templates.lunghimediagroup.com templates.lunghimediagroup.com
tour.genevirtualtours.com tour.genevirtualtours.com
tour.higginbothammedia.com tour.higginbothammedia.com
tour.seacoastrephotography.com tour.seacoastrephotography.com
tours.amazingphotovideo.com tours.amazingphotovideo.com
tours.blueoceanmiami.com tours.blueoceanmiami.com
tours.caldecott.com tours.caldecott.com
tours.dronetoursllc.com tours.dronetoursllc.com
tours.justaskjask.com tours.justaskjask.com
tours.newvisionstudio.com tours.newvisionstudio.com
tours.photoconnor.com tours.photoconnor.com
tours.riptidemedia.net tours.riptidemedia.net
tours.srq360media.com tours.srq360media.com
tours.vrsquadinc.com tours.vrsquadinc.com
user.vividvm.com user.vividvm.com
virtualtour.c21colonial.ca virtualtour.c21colonial.ca
westgissingroad.com westgissingroad.com
your.virtualdreamspaces.com your.virtualdreamspaces.com
zibicondo.com zibicondo.com
u.listvt.com u.listvt.com
client.goproptech.com client.goproptech.com
clients.cre8r.agency clients.cre8r.agency
clients.jackvatcherphotography.com clients.jackvatcherphotography.com
clients.thehomebird.com clients.thehomebird.com
comehome.to comehome.to
daxcourt.com daxcourt.com
featured.islandsothebysrealty.com featured.islandsothebysrealty.com
homes.btwimages.com homes.btwimages.com
homes.ejp.photo homes.ejp.photo
homes.motioncitymedia.com homes.motioncitymedia.com
homes.thecornerstoneteam.com homes.thecornerstoneteam.com
irownwoodcrossingqc.com irownwoodcrossingqc.com
kensingtontic.com kensingtontic.com
listedhq.com listedhq.com
listing.growthehive.com listing.growthehive.com
listing.hiverealestatemedia.com listing.hiverealestatemedia.com
listing.morrisonteam.com listing.morrisonteam.com
listing.trevisuality.com listing.trevisuality.com
listings.bokomedia.com listings.bokomedia.com
listings.homevideorealestate.com listings.homevideorealestate.com
listings.mhv.co listings.mhv.co
listings.picpros.ca listings.picpros.ca
listings.sevenimages.co listings.sevenimages.co
listings.zuwerksphotography.com listings.zuwerksphotography.com
listvt.com listvt.com
login.aimmedia.group login.aimmedia.group
login.treefort-media.com login.treefort-media.com
lwhometour.com lwhometour.com
lwopenhouse.com lwopenhouse.com
mysite.the3rdeye.ca mysite.the3rdeye.ca
oldesouthva.com oldesouthva.com
portal.virtualviewing.ca portal.virtualviewing.ca
preview.lystpros.com preview.lystpros.com
properties.360estatemedia.com properties.360estatemedia.com
properties.bolorphoto.com properties.bolorphoto.com
properties.scherbamedia.com properties.scherbamedia.com
realestate.wheelerhomeconcepts.com realestate.wheelerhomeconcepts.com
SITES.DISCOVERAERIAL.COM
IP History

Click the IP addresses to see over domains using them.