Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

BRYANGIRARD.US1.ADVISOR.WS

BRYANGIRARD.US1.ADVISOR.WS
Shared Attributes
Domain
kudrowichpwm.com kudrowichpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
loretoryder.com loretoryder.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 75 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mehrotragroup.com mehrotragroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mertenswealth.com mertenswealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mielefinancialgroup.ca mielefinancialgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
paziukandassociates.com paziukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
rickdellpwm.com rickdellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
agrawalassociates.ca agrawalassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 66 days
sylvielefebvre.com sylvielefebvre.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 52 days
thekilgourgroup.com thekilgourgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 54 days
tobacpwm.com tobacpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
trudybuttandassociates.com trudybuttandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
vignoneassociatespwm.com vignoneassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
buhrblaylock.com buhrblaylock.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 60 days
zarnlochheadpwm.com zarnlochheadpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jul 2024 1 year, 59 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 24 days
chiodobirkettandassociates.com chiodobirkettandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 15 days
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Mar 2023 2 days
chmprivatewealth.ca chmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
claudegallant.com claudegallant.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
courcellesgroup.com courcellesgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
equipedaoust.ca equipedaoust.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 105 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 57 days
equipemicheldesbiens.com equipemicheldesbiens.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
farrowandassociatespwm.com farrowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 16 days
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Mar 2023 16 days
floermillikengroup.com floermillikengroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
garofaloandassociates.ca garofaloandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
jeffsomerspwm.com jeffsomerspwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Aug 2023 145 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
jenningsandassociates.ca jenningsandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Apr 2023 26 days
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
juddbissonandassociates.com juddbissonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
karasickprivatewealth.com karasickprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2023 89 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
kevinkaiser.ca kevinkaiser.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
landriaultpwm.com landriaultpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 89 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 44 days
lehouxgestionprivee.com lehouxgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
lisabell.ca lisabell.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Mar 2023 Apr 2023 31 days
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Apr 2023 31 days
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Mar 2023 Apr 2023 31 days
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Apr 2023 31 days
loboandassociatespwm.ca loboandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
macmahonandassociates.com macmahonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2023 93 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mignaultprivatewealth.com mignaultprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 90 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
milngroup.com milngroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mondouetassocies.com mondouetassocies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 76 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Apr 2023 41 days
peterdefrancesco.com peterdefrancesco.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 91 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 92 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
powellpwm.com powellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
princeandassociates.ca princeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
ryangroupwealth.com ryangroupwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
schillerspence.ca schillerspence.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Feb 2024 341 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
snowandassociatespwm.com snowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Apr 2023 51 days
stevenboydpwm.com stevenboydpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 55 days
vickendurgerian.com vickendurgerian.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jul 2024 1 year, 62 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 14 days
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 115 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 58 days
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 77 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 77 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
brodieandassociates.com brodieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
carneylyster.com carneylyster.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
carterprivatewealth.com carterprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
charbonneauetassocies.ca charbonneauetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
colbournegroup.com colbournegroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 115 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
coleentaylor.ca coleentaylor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
dehartandassociates.com dehartandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
donfox.net donfox.net
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
edbootle.ca edbootle.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
elliottchaulk.com elliottchaulk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
equipetremblay.com equipetremblay.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
gabechiodo.ca gabechiodo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jul 2024 1 year, 46 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 11 days
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 54 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
ginettebradette.ca ginettebradette.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Dec 2023 274 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 21 days
harveypwm.ca harveypwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
irenevassalo.com irenevassalo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 73 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
jasondaleo.ca jasondaleo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 260 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 46 days
jennerandassociates.com jennerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
jenningsgroup.ca jenningsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
johnmazziotti.com johnmazziotti.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 221 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
roesthovesquire.ca roesthovesquire.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 69 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 21 days
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Apr 2023 51 days
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 94 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
sylvainmorin.ca sylvainmorin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 94 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 52 days
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 52 days
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2023 52 days
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 54 days
thiessenpwm.com thiessenpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
tmassociates.ca tmassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 55 days
wannerandassociates.ca wannerandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
brentmacdonald.ca brentmacdonald.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
wherryandassociates.ca wherryandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 116 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 59 days
woodwardandassociates.ca woodwardandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
costantinigroup.ca costantinigroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
dallaireandassociates.ca dallaireandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
danylukandassociates.com danylukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
ddkpwm.ca ddkpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
dupuispwm.com dupuispwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
equipealainbrunet.com equipealainbrunet.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
equipemarcantoinereid.com equipemarcantoinereid.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
equipesimonaube.com equipesimonaube.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
equipeyanickjuneau.ca equipeyanickjuneau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
flanaganandassociates.ca flanaganandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Dec 2023 270 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
gerberteam.com gerberteam.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
girardandassociates.com girardandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
godwinandassociates.ca godwinandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
hoffmangrouppwm.ca hoffmangrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 73 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
jasonblucke.com jasonblucke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
jeffsmithpwm.ca jeffsmithpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
kenwardgrouppwm.com kenwardgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 91 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
kucherawyandassociates.ca kucherawyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Apr 2023 One Off
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Apr 2023 32 days
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 108 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jun 2024 1 year, 75 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 38 days
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 108 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jan 2024 319 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
pentzwebsterandassociates.com pentzwebsterandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 78 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
philippedumont.com philippedumont.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 92 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 77 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 29 days
pompu.ca pompu.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
reishelpwm.com reishelpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
richardwutzke.com richardwutzke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
robeby.com robeby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
robeby.us1.advisor.ws robeby.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
runzerandassociates.com runzerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Jul 2024 1 year, 14 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 33 days
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
santosandassociates.ca santosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 72 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 24 days
sharmaandassociatespwm.com sharmaandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
anna-marierasmussen.ca anna-marierasmussen.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Sep 2023 182 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 67 days
stranskyandassociates.ca stranskyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Apr 2023 51 days
thlprivatewealth.com thlprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 54 days
toddandassociatespwm.com toddandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
bastgroup.ca bastgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 232 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 76 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
brunotherrien.ca brunotherrien.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
dalesmallgroup.ca dalesmallgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
deprezandassociates.com deprezandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
desfossesgoulet.ca desfossesgoulet.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
elaineandrewandassociates.com elaineandrewandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
equipejeanthomasmenard.com equipejeanthomasmenard.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
equipelaforme.com equipelaforme.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
equipelptoupin.ca equipelptoupin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
greghillaby.com greghillaby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Jul 2024 1 year, 35 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 49 days
hallamandassociates.com hallamandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
hansonprivatewealth.ca hansonprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 74 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
jwrossandassociates.ca jwrossandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
kathyduguaypwm.com kathyduguaypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 91 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
leboeufpwm.com leboeufpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
loweandassociates.ca loweandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
macdougallandmaticpwm.com macdougallandmaticpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
marianasemenchuk.com marianasemenchuk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 108 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 109 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mcinroypwm.com mcinroypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 85 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
methorstandassociates.ca methorstandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
mhmrpwm.ca mhmrpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
nolinandassociatespwm.com nolinandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2023 98 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
nathalygagnon.com nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 May 2024 226 days
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
salsbury.ca salsbury.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2024 Jul 2024 145 days
scepanovicandassociates.com scepanovicandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
seeleyandshoemaker.com seeleyandshoemaker.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
sharifosterandassociates.ca sharifosterandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 26 days
simundsonandassociates.ca simundsonandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 70 days
slaunwhiteandassociates.ca slaunwhiteandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 6 days
stephenstruthers.us1.advisor.ws stephenstruthers.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 65 days
stevensandassociates.ca stevensandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Jul 2024 257 days
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 94 days
baileyassociates.ca baileyassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 47 days
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
bcbgestionprivee.com bcbgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2024 358 days
beaulieulebuis.com beaulieulebuis.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 87 days
benkeandassociates.com benkeandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Apr 2024 1 year, 32 days
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Mar 2024 362 days
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 76 days
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
wolkerandassociatespwm.com wolkerandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
cameronrennieandassociates.com cameronrennieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2024 355 days
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2024 352 days
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
davedesrochers.ca davedesrochers.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jul 2024 1 year, 43 days
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 87 days
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
finchgoodale.com finchgoodale.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jul 2024 1 year, 38 days
fredpentz.us1.advisor.ws fredpentz.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 59 days
gagrawal.us1.advisor.ws gagrawal.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 70 days
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
jonathandaviespwm.ca jonathandaviespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 69 days
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Dec 2023 201 days
kennedyassociateswm.us1.advisor.ws kennedyassociateswm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 68 days
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
anjalijensen.com anjalijensen.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 94 days
markewert.com markewert.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 86 days
bourgeaultandassociates.com bourgeaultandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
metzgergroup.ca metzgergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Jul 2024 332 days
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
canningandpoolegroup.ca canningandpoolegroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jul 2024 One Off
chsmwealth.ca chsmwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 37 days
mauriziomastroianni.com mauriziomastroianni.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 56 days
freemangroup.ca freemangroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
kalinkaprivatewealth.com kalinkaprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Jul 2024 1 year, 30 days
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 92 days
kcmprivatewealth.ca kcmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Jul 2024 337 days
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
leavittgroup.ca leavittgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
markewert.us1.advisor.ws markewert.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 108 days
millarddawes.com millarddawes.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jan 2024 310 days
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
nolintoogood.ca nolintoogood.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Jul 2024 329 days
nturner.us1.advisor.ws nturner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
paughcarlsonwealth.ca paughcarlsonwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 9 days
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 76 days
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 224 days
seeleygroup.ca seeleygroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Jul 2024 260 days
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Nov 2023 121 days
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 68 days
spenceandassociatespwm.com spenceandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 54 days
stephenjudd.us1.advisor.ws stephenjudd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 65 days
beginbattinggroup.ca beginbattinggroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 61 days
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Mar 2024 1 year
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Mar 2024 194 days
vinerandselig.ca vinerandselig.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jul 2024 4 days
walshmckenziedegroot.com walshmckenziedegroot.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Jul 2024 310 days
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
clairehallam.us1.advisor.ws clairehallam.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 71 days
claudegallantandassociates.com claudegallantandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Nov 2023 257 days
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
desrochersassociates.us1.advisor.ws desrochersassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jun 2024 40 days
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
equipeyl.ca equipeyl.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 70 days
gibbingsandassociates.com gibbingsandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 74 days
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 74 days
mcgrathandassociateswm.com mcgrathandassociateswm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 10 days
greengrouppwm.com greengrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 99 days
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
huebertandassociates.com huebertandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 69 days
clayfung.ca clayfung.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Jul 2024 230 days
anholtgroup.ca anholtgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Jul 2024 239 days
mariodufouretassociees.ca mariodufouretassociees.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 11 days
hopkinspopeandassociates.ca hopkinspopeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jul 2024 1 day
michelleboeuf.us1.advisor.ws michelleboeuf.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 67 days
fayeafshar.com fayeafshar.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
marcovendramini.com marcovendramini.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Mar 2023 Apr 2023 28 days
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
rawlukprivatewealth.com rawlukprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
rspence.us1.advisor.ws rspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
scottsyrja.com scottsyrja.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 93 days
spencelockiegroup.ca spencelockiegroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 53 days
taylorzapotoczny.com taylorzapotoczny.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
themorristeam.ca themorristeam.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 118 days
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Mar 2024 1 year, 1 day
wiartpearsonakle.com wiartpearsonakle.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 63 days
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 87 days
davidhames.ca davidhames.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 87 days
dhames.us1.advisor.ws dhames.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
donfox.us1.advisor.ws donfox.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 91 days
duanerunzer.us1.advisor.ws duanerunzer.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 70 days
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
equipegilbertpereira.com equipegilbertpereira.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 95 days
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
esserprivatewealth.com esserprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
floerfarrowpwm.com floerfarrowpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Sep 2023 197 days
foxrevettassociates.com foxrevettassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
gobelandassociates.com gobelandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Dec 2023 279 days
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 115 days
johncornwallandassociates.com johncornwallandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
karlchoquettegestionprivee.ca karlchoquettegestionprivee.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 31 days
larmandgroup.com larmandgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
mabeeandassociatespwm.com mabeeandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jan 2024 298 days
mastroianniassociatespwm.us1.advisor.ws mastroianniassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 68 days
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 May 2024 288 days
millardwealth.com millardwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 67 days
naultgrouppwm.ca naultgrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
osmondfindlay.us1.advisor.ws osmondfindlay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2024 May 2024 118 days
bayandassociates.ca bayandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
berardinelligroup.com berardinelligroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 86 days
amandagraham-rowe.com amandagraham-rowe.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 50 days
blackbelyea.com blackbelyea.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
bouwmeestergroup.ca bouwmeestergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 83 days
syrja.ca syrja.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
dumitruflanaganandassociates.com dumitruflanaganandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 70 days
markwebster.ca markwebster.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 68 days
lacassedelariera.com lacassedelariera.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
karenandkayla.ca karenandkayla.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
dennishuntandassociates.ca dennishuntandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
dewashrafandassociates.ca dewashrafandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 34 days
squireassociates.ca squireassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Mar 2023 Apr 2023 40 days
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
robdaumler.com robdaumler.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
sandraramosandassociates.ca sandraramosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Jul 2024 260 days
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Feb 2024 341 days
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Jul 2024 259 days
sidarosetassocies.ca sidarosetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 41 days
sifnakisgroup.com sifnakisgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Jul 2024 1 year, 12 days
slaunwhiteassociates.us1.advisor.ws slaunwhiteassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 65 days
anholtgrouppwm.us1.advisor.ws anholtgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jul 2024 62 days
angelomanzo.com angelomanzo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 94 days
backup002.us1.advisor.ws backup002.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jun 2024 30 days
thomassavage.ca thomassavage.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 95 days
vanderschuitlamb.ca vanderschuitlamb.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jul 2024 4 days
wanandassociates.com wanandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Jul 2024 248 days
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Mar 2024 253 days
wheelermcivor.ca wheelermcivor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Jul 2024 310 days
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2024 355 days
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2023 One Off
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2023 Jul 2024 292 days
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
elevateyourwealth.ca elevateyourwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jul 2024 1 year, 40 days
equipebenoitlauzon.ca equipebenoitlauzon.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 33 days
equipefrancismarleau.ca equipefrancismarleau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 33 days
evanriddell.com evanriddell.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2023 Jul 2024 218 days
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jun 2024 1 year, 98 days
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 72 days
gaylortachauer.ca gaylortachauer.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
halsimonson.ca halsimonson.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 69 days
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
lalliandassociates.com lalliandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 207 days
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
osmondfindlay.ca osmondfindlay.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Jul 2024 267 days
paulvaillancourt.com paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
rapwm.com rapwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 221 days
kapwm.ca kapwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
jesseharris.ca jesseharris.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2023 Jul 2024 197 days
mcclureandcassar.ca mcclureandcassar.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 10 days
daviesmahnke.com daviesmahnke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
budhuandassociates.ca budhuandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 81 days
giannonejoncasetassocies.ca giannonejoncasetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 13 days
donnellygrouppwm.com donnellygrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
geeandassociates.ca geeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
dawsonandassociatespwm.com dawsonandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
groupeberardinelli.com groupeberardinelli.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 69 days
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
groupemanzo.com groupemanzo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 69 days
lyleandassociatespwm.ca lyleandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 11 days
dionetassocies.ca dionetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jul 2024 34 days
BRYANGIRARD.US1.ADVISOR.WS
Non IP Attributes
Attribute First Last
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023
BRYANGIRARD.US1.ADVISOR.WS
Overlap Attribute Domains
kudrowichpwm.com kudrowichpwm.com
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
loretoryder.com loretoryder.com
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
mehrotragroup.com mehrotragroup.com
mertenswealth.com mertenswealth.com
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
mielefinancialgroup.ca mielefinancialgroup.ca
paziukandassociates.com paziukandassociates.com
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
rickdellpwm.com rickdellpwm.com
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
agrawalassociates.ca agrawalassociates.ca
sylvielefebvre.com sylvielefebvre.com
thekilgourgroup.com thekilgourgroup.com
tobacpwm.com tobacpwm.com
trudybuttandassociates.com trudybuttandassociates.com
vignoneassociatespwm.com vignoneassociatespwm.com
buhrblaylock.com buhrblaylock.com
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
zarnlochheadpwm.com zarnlochheadpwm.com
chiodobirkettandassociates.com chiodobirkettandassociates.com
chmprivatewealth.ca chmprivatewealth.ca
claudegallant.com claudegallant.com
courcellesgroup.com courcellesgroup.com
equipedaoust.ca equipedaoust.ca
equipemicheldesbiens.com equipemicheldesbiens.com
farrowandassociatespwm.com farrowandassociatespwm.com
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
floermillikengroup.com floermillikengroup.com
garofaloandassociates.ca garofaloandassociates.ca
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
jeffsomerspwm.com jeffsomerspwm.com
jenningsandassociates.ca jenningsandassociates.ca
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
juddbissonandassociates.com juddbissonandassociates.com
karasickprivatewealth.com karasickprivatewealth.com
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
kevinkaiser.ca kevinkaiser.ca
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
landriaultpwm.com landriaultpwm.com
lehouxgestionprivee.com lehouxgestionprivee.com
lisabell.ca lisabell.ca
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
loboandassociatespwm.ca loboandassociatespwm.ca
macmahonandassociates.com macmahonandassociates.com
mignaultprivatewealth.com mignaultprivatewealth.com
milngroup.com milngroup.com
mondouetassocies.com mondouetassocies.com
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
peterdefrancesco.com peterdefrancesco.com
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
powellpwm.com powellpwm.com
princeandassociates.ca princeandassociates.ca
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
ryangroupwealth.com ryangroupwealth.com
schillerspence.ca schillerspence.ca
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
snowandassociatespwm.com snowandassociatespwm.com
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
stevenboydpwm.com stevenboydpwm.com
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
vickendurgerian.com vickendurgerian.com
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
brodieandassociates.com brodieandassociates.com
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
carneylyster.com carneylyster.com
carterprivatewealth.com carterprivatewealth.com
charbonneauetassocies.ca charbonneauetassocies.ca
colbournegroup.com colbournegroup.com
coleentaylor.ca coleentaylor.ca
dehartandassociates.com dehartandassociates.com
donfox.net donfox.net
edbootle.ca edbootle.ca
elliottchaulk.com elliottchaulk.com
equipetremblay.com equipetremblay.com
gabechiodo.ca gabechiodo.ca
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
ginettebradette.ca ginettebradette.ca
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
harveypwm.ca harveypwm.ca
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
irenevassalo.com irenevassalo.com
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
jasondaleo.ca jasondaleo.ca
jennerandassociates.com jennerandassociates.com
jenningsgroup.ca jenningsgroup.ca
johnmazziotti.com johnmazziotti.com
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
roesthovesquire.ca roesthovesquire.ca
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
sylvainmorin.ca sylvainmorin.ca
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
thiessenpwm.com thiessenpwm.com
tmassociates.ca tmassociates.ca
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
wannerandassociates.ca wannerandassociates.ca
brentmacdonald.ca brentmacdonald.ca
wherryandassociates.ca wherryandassociates.ca
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
woodwardandassociates.ca woodwardandassociates.ca
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
costantinigroup.ca costantinigroup.ca
dallaireandassociates.ca dallaireandassociates.ca
danylukandassociates.com danylukandassociates.com
ddkpwm.ca ddkpwm.ca
dupuispwm.com dupuispwm.com
equipealainbrunet.com equipealainbrunet.com
equipemarcantoinereid.com equipemarcantoinereid.com
equipesimonaube.com equipesimonaube.com
equipeyanickjuneau.ca equipeyanickjuneau.ca
flanaganandassociates.ca flanaganandassociates.ca
gerberteam.com gerberteam.com
girardandassociates.com girardandassociates.com
godwinandassociates.ca godwinandassociates.ca
hoffmangrouppwm.ca hoffmangrouppwm.ca
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
jasonblucke.com jasonblucke.com
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
jeffsmithpwm.ca jeffsmithpwm.ca
kenwardgrouppwm.com kenwardgrouppwm.com
kucherawyandassociates.ca kucherawyandassociates.ca
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
pentzwebsterandassociates.com pentzwebsterandassociates.com
philippedumont.com philippedumont.com
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
pompu.ca pompu.ca
reishelpwm.com reishelpwm.com
richardwutzke.com richardwutzke.com
robeby.com robeby.com
robeby.us1.advisor.ws robeby.us1.advisor.ws
runzerandassociates.com runzerandassociates.com
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
santosandassociates.ca santosandassociates.ca
sharmaandassociatespwm.com sharmaandassociatespwm.com
anna-marierasmussen.ca anna-marierasmussen.ca
stranskyandassociates.ca stranskyandassociates.ca
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
thlprivatewealth.com thlprivatewealth.com
toddandassociatespwm.com toddandassociatespwm.com
bastgroup.ca bastgroup.ca
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
brunotherrien.ca brunotherrien.ca
dalesmallgroup.ca dalesmallgroup.ca
deprezandassociates.com deprezandassociates.com
desfossesgoulet.ca desfossesgoulet.ca
elaineandrewandassociates.com elaineandrewandassociates.com
equipejeanthomasmenard.com equipejeanthomasmenard.com
equipelaforme.com equipelaforme.com
equipelptoupin.ca equipelptoupin.ca
greghillaby.com greghillaby.com
hallamandassociates.com hallamandassociates.com
hansonprivatewealth.ca hansonprivatewealth.ca
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
jwrossandassociates.ca jwrossandassociates.ca
kathyduguaypwm.com kathyduguaypwm.com
leboeufpwm.com leboeufpwm.com
loweandassociates.ca loweandassociates.ca
macdougallandmaticpwm.com macdougallandmaticpwm.com
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
marianasemenchuk.com marianasemenchuk.com
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
mcinroypwm.com mcinroypwm.com
methorstandassociates.ca methorstandassociates.ca
mhmrpwm.ca mhmrpwm.ca
nolinandassociatespwm.com nolinandassociatespwm.com
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
nathalygagnon.com nathalygagnon.com
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
salsbury.ca salsbury.ca
scepanovicandassociates.com scepanovicandassociates.com
seeleyandshoemaker.com seeleyandshoemaker.com
sharifosterandassociates.ca sharifosterandassociates.ca
simundsonandassociates.ca simundsonandassociates.ca
slaunwhiteandassociates.ca slaunwhiteandassociates.ca
stephenstruthers.us1.advisor.ws stephenstruthers.us1.advisor.ws
stevensandassociates.ca stevensandassociates.ca
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
baileyassociates.ca baileyassociates.ca
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
bcbgestionprivee.com bcbgestionprivee.com
beaulieulebuis.com beaulieulebuis.com
benkeandassociates.com benkeandassociates.com
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
wolkerandassociatespwm.com wolkerandassociatespwm.com
cameronrennieandassociates.com cameronrennieandassociates.com
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
davedesrochers.ca davedesrochers.ca
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
finchgoodale.com finchgoodale.com
fredpentz.us1.advisor.ws fredpentz.us1.advisor.ws
gagrawal.us1.advisor.ws gagrawal.us1.advisor.ws
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
jonathandaviespwm.ca jonathandaviespwm.ca
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
kennedyassociateswm.us1.advisor.ws kennedyassociateswm.us1.advisor.ws
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
anjalijensen.com anjalijensen.com
markewert.com markewert.com
bourgeaultandassociates.com bourgeaultandassociates.com
metzgergroup.ca metzgergroup.ca
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
canningandpoolegroup.ca canningandpoolegroup.ca
chsmwealth.ca chsmwealth.ca
mauriziomastroianni.com mauriziomastroianni.com
freemangroup.ca freemangroup.ca
kalinkaprivatewealth.com kalinkaprivatewealth.com
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
kcmprivatewealth.ca kcmprivatewealth.ca
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
leavittgroup.ca leavittgroup.ca
markewert.us1.advisor.ws markewert.us1.advisor.ws
millarddawes.com millarddawes.com
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
nolintoogood.ca nolintoogood.ca
nturner.us1.advisor.ws nturner.us1.advisor.ws
paughcarlsonwealth.ca paughcarlsonwealth.ca
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
seeleygroup.ca seeleygroup.ca
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
spenceandassociatespwm.com spenceandassociatespwm.com
stephenjudd.us1.advisor.ws stephenjudd.us1.advisor.ws
beginbattinggroup.ca beginbattinggroup.ca
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
vinerandselig.ca vinerandselig.ca
walshmckenziedegroot.com walshmckenziedegroot.com
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
clairehallam.us1.advisor.ws clairehallam.us1.advisor.ws
claudegallantandassociates.com claudegallantandassociates.com
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
desrochersassociates.us1.advisor.ws desrochersassociates.us1.advisor.ws
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
equipeyl.ca equipeyl.ca
gibbingsandassociates.com gibbingsandassociates.com
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
mcgrathandassociateswm.com mcgrathandassociateswm.com
greengrouppwm.com greengrouppwm.com
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
huebertandassociates.com huebertandassociates.com
clayfung.ca clayfung.ca
anholtgroup.ca anholtgroup.ca
mariodufouretassociees.ca mariodufouretassociees.ca
hopkinspopeandassociates.ca hopkinspopeandassociates.ca
michelleboeuf.us1.advisor.ws michelleboeuf.us1.advisor.ws
fayeafshar.com fayeafshar.com
marcovendramini.com marcovendramini.com
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
rawlukprivatewealth.com rawlukprivatewealth.com
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
rspence.us1.advisor.ws rspence.us1.advisor.ws
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
scottsyrja.com scottsyrja.com
spencelockiegroup.ca spencelockiegroup.ca
taylorzapotoczny.com taylorzapotoczny.com
themorristeam.ca themorristeam.ca
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
wiartpearsonakle.com wiartpearsonakle.com
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
davidhames.ca davidhames.ca
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
dhames.us1.advisor.ws dhames.us1.advisor.ws
donfox.us1.advisor.ws donfox.us1.advisor.ws
duanerunzer.us1.advisor.ws duanerunzer.us1.advisor.ws
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
equipegilbertpereira.com equipegilbertpereira.com
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
esserprivatewealth.com esserprivatewealth.com
floerfarrowpwm.com floerfarrowpwm.com
foxrevettassociates.com foxrevettassociates.com
gobelandassociates.com gobelandassociates.com
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
johncornwallandassociates.com johncornwallandassociates.com
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
karlchoquettegestionprivee.ca karlchoquettegestionprivee.ca
larmandgroup.com larmandgroup.com
mabeeandassociatespwm.com mabeeandassociatespwm.com
mastroianniassociatespwm.us1.advisor.ws mastroianniassociatespwm.us1.advisor.ws
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
millardwealth.com millardwealth.com
naultgrouppwm.ca naultgrouppwm.ca
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
osmondfindlay.us1.advisor.ws osmondfindlay.us1.advisor.ws
bayandassociates.ca bayandassociates.ca
berardinelligroup.com berardinelligroup.com
amandagraham-rowe.com amandagraham-rowe.com
blackbelyea.com blackbelyea.com
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
bouwmeestergroup.ca bouwmeestergroup.ca
syrja.ca syrja.ca
dumitruflanaganandassociates.com dumitruflanaganandassociates.com
markwebster.ca markwebster.ca
lacassedelariera.com lacassedelariera.com
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
karenandkayla.ca karenandkayla.ca
dennishuntandassociates.ca dennishuntandassociates.ca
dewashrafandassociates.ca dewashrafandassociates.ca
squireassociates.ca squireassociates.ca
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
robdaumler.com robdaumler.com
sandraramosandassociates.ca sandraramosandassociates.ca
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
sidarosetassocies.ca sidarosetassocies.ca
sifnakisgroup.com sifnakisgroup.com
slaunwhiteassociates.us1.advisor.ws slaunwhiteassociates.us1.advisor.ws
anholtgrouppwm.us1.advisor.ws anholtgrouppwm.us1.advisor.ws
angelomanzo.com angelomanzo.com
backup002.us1.advisor.ws backup002.us1.advisor.ws
thomassavage.ca thomassavage.ca
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
vanderschuitlamb.ca vanderschuitlamb.ca
wanandassociates.com wanandassociates.com
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
wheelermcivor.ca wheelermcivor.ca
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
elevateyourwealth.ca elevateyourwealth.ca
equipebenoitlauzon.ca equipebenoitlauzon.ca
equipefrancismarleau.ca equipefrancismarleau.ca
evanriddell.com evanriddell.com
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
gaylortachauer.ca gaylortachauer.ca
halsimonson.ca halsimonson.ca
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
lalliandassociates.com lalliandassociates.com
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
osmondfindlay.ca osmondfindlay.ca
paulvaillancourt.com paulvaillancourt.com
rapwm.com rapwm.com
kapwm.ca kapwm.ca
jesseharris.ca jesseharris.ca
mcclureandcassar.ca mcclureandcassar.ca
daviesmahnke.com daviesmahnke.com
budhuandassociates.ca budhuandassociates.ca
giannonejoncasetassocies.ca giannonejoncasetassocies.ca
donnellygrouppwm.com donnellygrouppwm.com
geeandassociates.ca geeandassociates.ca
dawsonandassociatespwm.com dawsonandassociatespwm.com
groupeberardinelli.com groupeberardinelli.com
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
groupemanzo.com groupemanzo.com
lyleandassociatespwm.ca lyleandassociatespwm.ca
dionetassocies.ca dionetassocies.ca
BRYANGIRARD.US1.ADVISOR.WS
IP History

Click the IP addresses to see over domains using them.