Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

HENDRIKSHUEBERTANDASSOCIATES.COM

HENDRIKSHUEBERTANDASSOCIATES.COM
Shared Attributes
Domain
kudrowichpwm.com kudrowichpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 214 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 213 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
loretoryder.com loretoryder.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 212 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
mehrotragroup.com mehrotragroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Dec 2023 339 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
mertenswealth.com mertenswealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 209 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 72 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
mielefinancialgroup.ca mielefinancialgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
paziukandassociates.com paziukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 63 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
rickdellpwm.com rickdellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 194 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 194 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
agrawalassociates.ca agrawalassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Dec 2023 1 year, 27 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
sylvielefebvre.com sylvielefebvre.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
thekilgourgroup.com thekilgourgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
tobacpwm.com tobacpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
trudybuttandassociates.com trudybuttandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
vignoneassociatespwm.com vignoneassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 178 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
buhrblaylock.com buhrblaylock.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Dec 2023 1 year, 34 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
chiodobirkettandassociates.com chiodobirkettandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2023 323 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
chmprivatewealth.ca chmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Dec 2023 1 year, 109 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
courcellesgroup.com courcellesgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipemicheldesbiens.com equipemicheldesbiens.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
farrowandassociatespwm.com farrowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2023 337 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
floermillikengroup.com floermillikengroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 95 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
garofaloandassociates.ca garofaloandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jeffsomerspwm.com jeffsomerspwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Aug 2023 1 year, 81 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jenningsandassociates.ca jenningsandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Apr 2023 327 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2022 229 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
juddbissonandassociates.com juddbissonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
karasickprivatewealth.com karasickprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jun 2023 256 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 81 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
kevinkaiser.ca kevinkaiser.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 214 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 214 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
lehouxgestionprivee.com lehouxgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 213 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
lisabell.ca lisabell.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Apr 2023 329 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
loboandassociatespwm.ca loboandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Dec 2023 343 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
macmahonandassociates.com macmahonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jun 2023 254 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
mignaultprivatewealth.com mignaultprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
milngroup.com milngroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
mondouetassocies.com mondouetassocies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 70 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
peterdefrancesco.com peterdefrancesco.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 199 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 62 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
powellpwm.com powellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 198 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
ryangroupwealth.com ryangroupwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 55 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
snowandassociatespwm.com snowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 189 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
stevenboydpwm.com stevenboydpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Dec 2023 1 year, 17 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
brodieandassociates.com brodieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
carneylyster.com carneylyster.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
carterprivatewealth.com carterprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
charbonneauetassocies.ca charbonneauetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Dec 2023 1 year, 109 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
coleentaylor.ca coleentaylor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Dec 2023 1 year, 107 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
dehartandassociates.com dehartandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
donfox.net donfox.net
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
edbootle.ca edbootle.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
elliottchaulk.com elliottchaulk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipetremblay.com equipetremblay.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
ginettebradette.ca ginettebradette.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 230 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
harveypwm.ca harveypwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 89 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
irenevassalo.com irenevassalo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 232 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jennerandassociates.com jennerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jenningsgroup.ca jenningsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
johnmazziotti.com johnmazziotti.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 48 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
sylvainmorin.ca sylvainmorin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 May 2023 185 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
thiessenpwm.com thiessenpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Dec 2023 1 year, 20 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
tmassociates.ca tmassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
blackbelyea.com blackbelyea.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2022 Dec 2023 1 year, 151 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
wannerandassociates.ca wannerandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
brentmacdonald.ca brentmacdonald.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
wherryandassociates.ca wherryandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
woodwardandassociates.ca woodwardandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
costantinigroup.ca costantinigroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
dallaireandassociates.ca dallaireandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
danylukandassociates.com danylukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Dec 2023 1 year, 105 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
ddkpwm.ca ddkpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 104 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
dupuispwm.com dupuispwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Dec 2023 1 year, 5 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipealainbrunet.com equipealainbrunet.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipemarcantoinereid.com equipemarcantoinereid.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipesimonaube.com equipesimonaube.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipeyanickjuneau.ca equipeyanickjuneau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
flanaganandassociates.ca flanaganandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 226 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
gerberteam.com gerberteam.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
girardandassociates.com girardandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 92 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
godwinandassociates.ca godwinandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
hoffmangrouppwm.ca hoffmangrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jasonblucke.com jasonblucke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 83 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jeffsmithpwm.ca jeffsmithpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 83 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 214 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
kenwardgrouppwm.com kenwardgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 251 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
lylekarasick.com lylekarasick.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2023 99 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 210 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 71 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
philippedumont.com philippedumont.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 199 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
pompu.ca pompu.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 198 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
reishelpwm.com reishelpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 195 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
richardwutzke.com richardwutzke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 194 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
robeby.com robeby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 194 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
sharmaandassociatespwm.com sharmaandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
anna-marierasmussen.ca anna-marierasmussen.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2023 1 year, 138 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
squireassociates.ca squireassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2023 102 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
stranskyandassociates.ca stranskyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 48 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
thlprivatewealth.com thlprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Dec 2023 1 year, 43 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
toddandassociatespwm.com toddandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
bastgroup.ca bastgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Dec 2023 1 year, 20 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 188 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Feb 2023 102 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2022 Dec 2023 1 year, 151 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
brunotherrien.ca brunotherrien.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
dalesmallgroup.ca dalesmallgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Dec 2023 1 year, 9 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
deprezandassociates.com deprezandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Dec 2023 1 year, 8 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
desfossesgoulet.ca desfossesgoulet.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 104 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
elaineandrewandassociates.com elaineandrewandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipejeanthomasmenard.com equipejeanthomasmenard.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 98 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipelaforme.com equipelaforme.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipelptoupin.ca equipelptoupin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 98 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
hallamandassociates.com hallamandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Dec 2023 358 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
hansonprivatewealth.ca hansonprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jwrossandassociates.ca jwrossandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 82 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
leboeufpwm.com leboeufpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 78 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
macdougallandmaticpwm.com macdougallandmaticpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Dec 2023 341 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 211 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
marianasemenchuk.com marianasemenchuk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 210 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 210 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
mhmrpwm.ca mhmrpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
nathalygagnon.com fr.nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
lovisandassociates.com lovisandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Sep 2022 137 days
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 210 days
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 210 days
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 73 days
nathalygagnon.com nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 205 days
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Dec 2023 64 days
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 56 days
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 56 days
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 56 days
scepanovicandassociates.com scepanovicandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 192 days
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 192 days
seeleyandshoemaker.com seeleyandshoemaker.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2023 101 days
simundsonandassociates.ca simundsonandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 230 days
stevensandassociates.ca stevensandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Dec 2023 52 days
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
bcbgestionprivee.com bcbgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Dec 2023 153 days
benkeandassociates.com benkeandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
brunotherrien.us1.advisor.ws brunotherrien.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Nov 2022 One Off
wolkerandassociatespwm.com wolkerandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
cameronrennieandassociates.com cameronrennieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Dec 2023 150 days
zarnlochheadpwm.com zarnlochheadpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Dec 2023 219 days
claudegallant.com claudegallant.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
claudegallantigprivatewealthcom.us1.advisor.ws claudegallantigprivatewealthcom.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Dec 2022 One Off
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Dec 2023 147 days
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
davedesrochers.ca davedesrochers.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Dec 2023 203 days
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
equipedaoust.ca equipedaoust.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Dec 2023 265 days
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2022 233 days
finchgoodale.com finchgoodale.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Dec 2023 198 days
freemangroup.us1.advisor.ws freemangroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
hopeandassociates.ca hopeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2022 147 days
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 233 days
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 82 days
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 214 days
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Dec 2023 190 days
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Dec 2023 1 year, 20 days
markewert.com markewert.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 246 days
bourgeaultandassociates.com bourgeaultandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
metzgergroup.ca metzgergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Dec 2023 127 days
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
freemangroup.ca freemangroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
igfr.us1.advisor.ws igfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
kalinkaprivatewealth.com kalinkaprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Dec 2023 190 days
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 252 days
kcmprivatewealth.ca kcmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Dec 2023 132 days
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 214 days
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 214 days
leavittgroup.ca leavittgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 213 days
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Apr 2023 193 days
markewert.us1.advisor.ws markewert.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 210 days
millarddawes.com millarddawes.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 208 days
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 68 days
nolintoogood.ca nolintoogood.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Dec 2023 124 days
nturner.us1.advisor.ws nturner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 203 days
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 63 days
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 63 days
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Dec 2023 327 days
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 100 days
princeandassociates.ca princeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Dec 2023 324 days
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 194 days
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 194 days
schillerspence.ca schillerspence.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Dec 2023 317 days
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 180 days
seeleygroup.ca seeleygroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Dec 2023 55 days
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Nov 2023 121 days
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
spenceandassociatespwm.com spenceandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
taylorzapotoczny.us1.advisor.ws taylorzapotoczny.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Jun 2022 One Off
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
vickendurgerian.com vickendurgerian.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Dec 2023 222 days
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Dec 2023 106 days
walshmckenziedegroot.com walshmckenziedegroot.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Dec 2023 105 days
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2023 Dec 2023 299 days
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Dec 2023 1 year, 36 days
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
claudegallantandassociates.com claudegallantandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
colbournegroup.com colbournegroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Dec 2023 275 days
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Nov 2023 1 year, 213 days
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Dec 2023 261 days
gibbingsandassociates.com gibbingsandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 234 days
jasondaleo.ca jasondaleo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 253 days
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 83 days
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
gabechiodo.ca gabechiodo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Dec 2023 206 days
greengrouppwm.com greengrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Dec 2023 259 days
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 82 days
clayfung.ca clayfung.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Dec 2023 25 days
anholtgroup.ca anholtgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Dec 2023 34 days
landriaultpwm.com landriaultpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 249 days
fayeafshar.com fayeafshar.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
marcovendramini.com marcovendramini.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 58 days
rawlukprivatewealth.com rawlukprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 195 days
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 56 days
roesthovesquire.ca roesthovesquire.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 229 days
rspence.us1.advisor.ws rspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 55 days
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 192 days
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 191 days
scottsyrja.com scottsyrja.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 53 days
taylorzapotoczny.com taylorzapotoczny.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
themorristeam.ca themorristeam.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Dec 2023 279 days
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Dec 2023 1 year, 9 days
davidhames.ca davidhames.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
dhames.us1.advisor.ws dhames.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
donfox.us1.advisor.ws donfox.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
equipegilbertpereira.com equipegilbertpereira.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 98 days
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
esserprivatewealth.com esserprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
floerfarrowpwm.com floerfarrowpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2023 1 year, 153 days
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
foxrevettassociates.com foxrevettassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2022 237 days
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
gobelandassociates.com gobelandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
johncornwallandassociates.com johncornwallandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2022 229 days
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 214 days
kjonesandassociates.ca kjonesandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2022 One Off
kucherawyandassociates.ca kucherawyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 214 days
lacassedelarierafr.us1.advisor.ws lacassedelarierafr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2023 97 days
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 213 days
larmandgroup.com larmandgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 213 days
mabeeandassociatespwm.com mabeeandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 211 days
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 99 days
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 73 days
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 246 days
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Dec 2023 127 days
naultgrouppwm.ca naultgrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 205 days
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 205 days
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 204 days
pentzwebsterandassociates.com pentzwebsterandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 238 days
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 199 days
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 237 days
bayandassociates.ca bayandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Dec 2023 1 year, 20 days
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
syrja.ca syrja.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
lacassedelariera.com lacassedelariera.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 213 days
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 75 days
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 93 days
karenandkayla.ca karenandkayla.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 214 days
dennishuntandassociates.ca dennishuntandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
paulvaillancourt.com fr.paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
robdaumler.com robdaumler.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 194 days
runzerandassociates.com runzerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Dec 2023 174 days
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 55 days
sandraramosandassociates.ca sandraramosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Dec 2023 55 days
santosandassociates.ca santosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 232 days
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 53 days
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Dec 2023 54 days
sifnakisgroup.com sifnakisgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Dec 2023 172 days
thomassavage.ca thomassavage.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
wanandassociates.com wanandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Dec 2023 43 days
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Dec 2023 163 days
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Dec 2023 280 days
wheelermcivor.ca wheelermcivor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Dec 2023 105 days
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Dec 2023 150 days
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2023 One Off
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2023 Dec 2023 87 days
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
elevateyourwealth.ca elevateyourwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Dec 2023 200 days
evanriddell.com evanriddell.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2023 Dec 2023 13 days
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
gaylortachauer.ca gaylortachauer.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
greghillaby.com greghillaby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Dec 2023 195 days
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2023 1 year, 83 days
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 215 days
kathyduguaypwm.com kathyduguaypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 251 days
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 213 days
lalliandassociates.com lalliandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 141 days
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 210 days
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 209 days
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2023 1 year, 71 days
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 99 days
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 205 days
nolinandassociatespwm.com nolinandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2023 1 year, 23 days
osmondfindlay.ca osmondfindlay.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Dec 2023 62 days
paulvaillancourt.com paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 200 days
rapwm.com rapwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 138 days
methorstandassociates.ca methorstandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 209 days
kapwm.ca kapwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Dec 2023 350 days
robeby.us1.advisor.ws robeby.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Dec 2023 1 year, 194 days
daviesmahnke.com daviesmahnke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
donnellygrouppwm.com donnellygrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
loweandassociates.ca loweandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2023 1 year, 212 days
mcinroypwm.com mcinroypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 245 days
geeandassociates.ca geeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
dawsonandassociatespwm.com dawsonandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
HENDRIKSHUEBERTANDASSOCIATES.COM
Non IP Attributes
Attribute First Last
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022
HENDRIKSHUEBERTANDASSOCIATES.COM
Overlap Attribute Domains
kudrowichpwm.com kudrowichpwm.com
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
loretoryder.com loretoryder.com
mehrotragroup.com mehrotragroup.com
mertenswealth.com mertenswealth.com
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
mielefinancialgroup.ca mielefinancialgroup.ca
paziukandassociates.com paziukandassociates.com
rickdellpwm.com rickdellpwm.com
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
agrawalassociates.ca agrawalassociates.ca
sylvielefebvre.com sylvielefebvre.com
thekilgourgroup.com thekilgourgroup.com
tobacpwm.com tobacpwm.com
trudybuttandassociates.com trudybuttandassociates.com
vignoneassociatespwm.com vignoneassociatespwm.com
buhrblaylock.com buhrblaylock.com
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
chiodobirkettandassociates.com chiodobirkettandassociates.com
chmprivatewealth.ca chmprivatewealth.ca
courcellesgroup.com courcellesgroup.com
equipemicheldesbiens.com equipemicheldesbiens.com
farrowandassociatespwm.com farrowandassociatespwm.com
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
floermillikengroup.com floermillikengroup.com
garofaloandassociates.ca garofaloandassociates.ca
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
jeffsomerspwm.com jeffsomerspwm.com
jenningsandassociates.ca jenningsandassociates.ca
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
juddbissonandassociates.com juddbissonandassociates.com
karasickprivatewealth.com karasickprivatewealth.com
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
kevinkaiser.ca kevinkaiser.ca
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
lehouxgestionprivee.com lehouxgestionprivee.com
lisabell.ca lisabell.ca
loboandassociatespwm.ca loboandassociatespwm.ca
macmahonandassociates.com macmahonandassociates.com
mignaultprivatewealth.com mignaultprivatewealth.com
milngroup.com milngroup.com
mondouetassocies.com mondouetassocies.com
peterdefrancesco.com peterdefrancesco.com
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
powellpwm.com powellpwm.com
ryangroupwealth.com ryangroupwealth.com
snowandassociatespwm.com snowandassociatespwm.com
stevenboydpwm.com stevenboydpwm.com
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
brodieandassociates.com brodieandassociates.com
carneylyster.com carneylyster.com
carterprivatewealth.com carterprivatewealth.com
charbonneauetassocies.ca charbonneauetassocies.ca
coleentaylor.ca coleentaylor.ca
dehartandassociates.com dehartandassociates.com
donfox.net donfox.net
edbootle.ca edbootle.ca
elliottchaulk.com elliottchaulk.com
equipetremblay.com equipetremblay.com
ginettebradette.ca ginettebradette.ca
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
harveypwm.ca harveypwm.ca
irenevassalo.com irenevassalo.com
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
jennerandassociates.com jennerandassociates.com
jenningsgroup.ca jenningsgroup.ca
johnmazziotti.com johnmazziotti.com
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
sylvainmorin.ca sylvainmorin.ca
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
thiessenpwm.com thiessenpwm.com
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
tmassociates.ca tmassociates.ca
blackbelyea.com blackbelyea.com
wannerandassociates.ca wannerandassociates.ca
brentmacdonald.ca brentmacdonald.ca
wherryandassociates.ca wherryandassociates.ca
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
woodwardandassociates.ca woodwardandassociates.ca
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
costantinigroup.ca costantinigroup.ca
dallaireandassociates.ca dallaireandassociates.ca
danylukandassociates.com danylukandassociates.com
ddkpwm.ca ddkpwm.ca
dupuispwm.com dupuispwm.com
equipealainbrunet.com equipealainbrunet.com
equipemarcantoinereid.com equipemarcantoinereid.com
equipesimonaube.com equipesimonaube.com
equipeyanickjuneau.ca equipeyanickjuneau.ca
flanaganandassociates.ca flanaganandassociates.ca
gerberteam.com gerberteam.com
girardandassociates.com girardandassociates.com
godwinandassociates.ca godwinandassociates.ca
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
hoffmangrouppwm.ca hoffmangrouppwm.ca
jasonblucke.com jasonblucke.com
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
jeffsmithpwm.ca jeffsmithpwm.ca
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
kenwardgrouppwm.com kenwardgrouppwm.com
lylekarasick.com lylekarasick.com
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
philippedumont.com philippedumont.com
pompu.ca pompu.ca
reishelpwm.com reishelpwm.com
richardwutzke.com richardwutzke.com
robeby.com robeby.com
sharmaandassociatespwm.com sharmaandassociatespwm.com
anna-marierasmussen.ca anna-marierasmussen.ca
squireassociates.ca squireassociates.ca
stranskyandassociates.ca stranskyandassociates.ca
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
thlprivatewealth.com thlprivatewealth.com
toddandassociatespwm.com toddandassociatespwm.com
bastgroup.ca bastgroup.ca
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
brunotherrien.ca brunotherrien.ca
dalesmallgroup.ca dalesmallgroup.ca
deprezandassociates.com deprezandassociates.com
desfossesgoulet.ca desfossesgoulet.ca
elaineandrewandassociates.com elaineandrewandassociates.com
equipejeanthomasmenard.com equipejeanthomasmenard.com
equipelaforme.com equipelaforme.com
equipelptoupin.ca equipelptoupin.ca
hallamandassociates.com hallamandassociates.com
hansonprivatewealth.ca hansonprivatewealth.ca
jwrossandassociates.ca jwrossandassociates.ca
leboeufpwm.com leboeufpwm.com
macdougallandmaticpwm.com macdougallandmaticpwm.com
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
marianasemenchuk.com marianasemenchuk.com
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
mhmrpwm.ca mhmrpwm.ca
fr.nathalygagnon.com fr.nathalygagnon.com
lovisandassociates.com lovisandassociates.com
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
nathalygagnon.com nathalygagnon.com
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
scepanovicandassociates.com scepanovicandassociates.com
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
seeleyandshoemaker.com seeleyandshoemaker.com
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
simundsonandassociates.ca simundsonandassociates.ca
stevensandassociates.ca stevensandassociates.ca
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
bcbgestionprivee.com bcbgestionprivee.com
benkeandassociates.com benkeandassociates.com
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
brunotherrien.us1.advisor.ws brunotherrien.us1.advisor.ws
wolkerandassociatespwm.com wolkerandassociatespwm.com
cameronrennieandassociates.com cameronrennieandassociates.com
zarnlochheadpwm.com zarnlochheadpwm.com
claudegallant.com claudegallant.com
claudegallantigprivatewealthcom.us1.advisor.ws claudegallantigprivatewealthcom.us1.advisor.ws
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
davedesrochers.ca davedesrochers.ca
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
equipedaoust.ca equipedaoust.ca
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
finchgoodale.com finchgoodale.com
freemangroup.us1.advisor.ws freemangroup.us1.advisor.ws
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
hopeandassociates.ca hopeandassociates.ca
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
markewert.com markewert.com
bourgeaultandassociates.com bourgeaultandassociates.com
metzgergroup.ca metzgergroup.ca
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
freemangroup.ca freemangroup.ca
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
igfr.us1.advisor.ws igfr.us1.advisor.ws
kalinkaprivatewealth.com kalinkaprivatewealth.com
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
kcmprivatewealth.ca kcmprivatewealth.ca
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
leavittgroup.ca leavittgroup.ca
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
markewert.us1.advisor.ws markewert.us1.advisor.ws
millarddawes.com millarddawes.com
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
nolintoogood.ca nolintoogood.ca
nturner.us1.advisor.ws nturner.us1.advisor.ws
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
princeandassociates.ca princeandassociates.ca
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
schillerspence.ca schillerspence.ca
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
seeleygroup.ca seeleygroup.ca
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
spenceandassociatespwm.com spenceandassociatespwm.com
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
taylorzapotoczny.us1.advisor.ws taylorzapotoczny.us1.advisor.ws
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
vickendurgerian.com vickendurgerian.com
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
walshmckenziedegroot.com walshmckenziedegroot.com
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
claudegallantandassociates.com claudegallantandassociates.com
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
colbournegroup.com colbournegroup.com
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
gibbingsandassociates.com gibbingsandassociates.com
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
jasondaleo.ca jasondaleo.ca
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
gabechiodo.ca gabechiodo.ca
greengrouppwm.com greengrouppwm.com
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
clayfung.ca clayfung.ca
anholtgroup.ca anholtgroup.ca
landriaultpwm.com landriaultpwm.com
fayeafshar.com fayeafshar.com
marcovendramini.com marcovendramini.com
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
rawlukprivatewealth.com rawlukprivatewealth.com
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
roesthovesquire.ca roesthovesquire.ca
rspence.us1.advisor.ws rspence.us1.advisor.ws
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
scottsyrja.com scottsyrja.com
taylorzapotoczny.com taylorzapotoczny.com
themorristeam.ca themorristeam.ca
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
davidhames.ca davidhames.ca
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
dhames.us1.advisor.ws dhames.us1.advisor.ws
donfox.us1.advisor.ws donfox.us1.advisor.ws
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
equipegilbertpereira.com equipegilbertpereira.com
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
esserprivatewealth.com esserprivatewealth.com
floerfarrowpwm.com floerfarrowpwm.com
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
foxrevettassociates.com foxrevettassociates.com
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
gobelandassociates.com gobelandassociates.com
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
johncornwallandassociates.com johncornwallandassociates.com
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
kjonesandassociates.ca kjonesandassociates.ca
kucherawyandassociates.ca kucherawyandassociates.ca
lacassedelarierafr.us1.advisor.ws lacassedelarierafr.us1.advisor.ws
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
larmandgroup.com larmandgroup.com
mabeeandassociatespwm.com mabeeandassociatespwm.com
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
naultgrouppwm.ca naultgrouppwm.ca
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
pentzwebsterandassociates.com pentzwebsterandassociates.com
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
bayandassociates.ca bayandassociates.ca
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
syrja.ca syrja.ca
lacassedelariera.com lacassedelariera.com
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
karenandkayla.ca karenandkayla.ca
dennishuntandassociates.ca dennishuntandassociates.ca
fr.paulvaillancourt.com fr.paulvaillancourt.com
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
robdaumler.com robdaumler.com
runzerandassociates.com runzerandassociates.com
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
sandraramosandassociates.ca sandraramosandassociates.ca
santosandassociates.ca santosandassociates.ca
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
sifnakisgroup.com sifnakisgroup.com
thomassavage.ca thomassavage.ca
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
wanandassociates.com wanandassociates.com
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
wheelermcivor.ca wheelermcivor.ca
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
elevateyourwealth.ca elevateyourwealth.ca
evanriddell.com evanriddell.com
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
gaylortachauer.ca gaylortachauer.ca
greghillaby.com greghillaby.com
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
kathyduguaypwm.com kathyduguaypwm.com
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
lalliandassociates.com lalliandassociates.com
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
nolinandassociatespwm.com nolinandassociatespwm.com
osmondfindlay.ca osmondfindlay.ca
paulvaillancourt.com paulvaillancourt.com
rapwm.com rapwm.com
methorstandassociates.ca methorstandassociates.ca
kapwm.ca kapwm.ca
robeby.us1.advisor.ws robeby.us1.advisor.ws
daviesmahnke.com daviesmahnke.com
donnellygrouppwm.com donnellygrouppwm.com
loweandassociates.ca loweandassociates.ca
mcinroypwm.com mcinroypwm.com
geeandassociates.ca geeandassociates.ca
dawsonandassociatespwm.com dawsonandassociatespwm.com
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
HENDRIKSHUEBERTANDASSOCIATES.COM
IP History

Click the IP addresses to see over domains using them.