RASMUSSENASSOCIATES.US1.ADVISOR.WS
Shared Attributes
Domain
kudrowichpwm.com kudrowichpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 133 days
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 134 days
loretoryder.com loretoryder.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 135 days
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
mehrotragroup.com mehrotragroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 281 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
mertenswealth.com mertenswealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 138 days
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 138 days
mielefinancialgroup.ca mielefinancialgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 138 days
nathalygagnon.com nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jun 2023 Jun 2023 One Off
paziukandassociates.com paziukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 143 days
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 363 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
rickdellpwm.com rickdellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 363 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 141 days
agrawalassociates.ca agrawalassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 334 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 109 days
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2023 101 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
sylvielefebvre.com sylvielefebvre.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 95 days
thekilgourgroup.com thekilgourgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 97 days
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
tobacpwm.com tobacpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 125 days
trudybuttandassociates.com trudybuttandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 125 days
vignoneassociatespwm.com vignoneassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 126 days
bourgeaultandassociates.com bourgeaultandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
buhrblaylock.com buhrblaylock.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 341 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 103 days
zarnlochheadpwm.com zarnlochheadpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 161 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 38 days
chiodobirkettandassociates.com chiodobirkettandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Mar 2023 146 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Mar 2023 58 days
chmprivatewealth.ca chmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 116 days
claudegallant.com claudegallant.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 138 days
courcellesgroup.com courcellesgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 118 days
equipedaoust.ca equipedaoust.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 207 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 66 days
equipemicheldesbiens.com equipemicheldesbiens.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 123 days
farrowandassociatespwm.com farrowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 124 days
finchgoodale.com finchgoodale.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 140 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Mar 2023 160 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Mar 2023 59 days
floermillikengroup.com floermillikengroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 143 days
garofaloandassociates.ca garofaloandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 143 days
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
jeffsomerspwm.com jeffsomerspwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2023 289 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 131 days
jenningsandassociates.ca jenningsandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Apr 2023 170 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 131 days
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 131 days
juddbissonandassociates.com juddbissonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 132 days
kalinkaprivatewealth.com kalinkaprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 132 days
GTM GTM-G-0FSFL4QW1Q Jun 2023 Jun 2023 14 days
karasickprivatewealth.com karasickprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jun 2023 233 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 132 days
kevinkaiser.ca kevinkaiser.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 132 days
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 133 days
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 133 days
landriaultpwm.com landriaultpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 191 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 64 days
lehouxgestionprivee.com lehouxgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 134 days
lisabell.ca lisabell.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Apr 2023 175 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 74 days
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Apr 2023 175 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 74 days
loboandassociatespwm.ca loboandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 285 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 135 days
macmahonandassociates.com macmahonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jun 2023 237 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 136 days
mignaultprivatewealth.com mignaultprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 138 days
milngroup.com milngroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
mondouetassocies.com mondouetassocies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 139 days
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 84 days
peterdefrancesco.com peterdefrancesco.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 269 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
powellpwm.com powellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 145 days
princeandassociates.ca princeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 266 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 145 days
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
ryangroupwealth.com ryangroupwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 362 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
schillerspence.ca schillerspence.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 259 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 141 days
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
snowandassociatespwm.com snowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Feb 2023 Apr 2023 83 days
stevenboydpwm.com stevenboydpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 81 days
vickendurgerian.com vickendurgerian.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 164 days
GTM GTM-G-0FSFL4QW1Q May 2023 Jun 2023 26 days
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2023 Oct 2023 241 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 78 days
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 324 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 114 days
brodieandassociates.com brodieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
carneylyster.com carneylyster.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 115 days
carterprivatewealth.com carterprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
charbonneauetassocies.ca charbonneauetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
colbournegroup.com colbournegroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 217 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 117 days
coleentaylor.ca coleentaylor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 138 days
dehartandassociates.com dehartandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 119 days
donfox.net donfox.net
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 140 days
edbootle.ca edbootle.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 141 days
elliottchaulk.com elliottchaulk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 141 days
equipetremblay.com equipetremblay.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
gabechiodo.ca gabechiodo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 148 days
GTM GTM-G-0FSFL4QW1Q May 2023 Jun 2023 40 days
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 203 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
ginettebradette.ca ginettebradette.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Mar 2023 64 days
harveypwm.ca harveypwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 128 days
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 129 days
irenevassalo.com irenevassalo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 130 days
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 131 days
jasondaleo.ca jasondaleo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 195 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 78 days
jennerandassociates.com jennerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 131 days
jenningsgroup.ca jenningsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
johnmazziotti.com johnmazziotti.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 131 days
roesthovesquire.ca roesthovesquire.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 171 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 53 days
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 94 days
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 355 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
sylvainmorin.ca sylvainmorin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 95 days
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 May 2023 185 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 95 days
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 81 days
thiessenpwm.com thiessenpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 125 days
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 327 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Mar 2023 39 days
tmassociates.ca tmassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 80 days
blackbelyea.com blackbelyea.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Mar 2023 41 days
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
wannerandassociates.ca wannerandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 127 days
brentmacdonald.ca brentmacdonald.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 114 days
wherryandassociates.ca wherryandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 127 days
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 221 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 102 days
woodwardandassociates.ca woodwardandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
costantinigroup.ca costantinigroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 138 days
dallaireandassociates.ca dallaireandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 139 days
danylukandassociates.com danylukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 139 days
ddkpwm.ca ddkpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 139 days
dupuispwm.com dupuispwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 312 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 121 days
equipealainbrunet.com equipealainbrunet.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
equipemarcantoinereid.com equipemarcantoinereid.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 142 days
equipesimonaube.com equipesimonaube.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 142 days
equipeyanickjuneau.ca equipeyanickjuneau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 142 days
flanaganandassociates.ca flanaganandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 124 days
gerberteam.com gerberteam.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
girardandassociates.com girardandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
godwinandassociates.ca godwinandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 126 days
hoffmangrouppwm.ca hoffmangrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 128 days
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 131 days
jasonblucke.com jasonblucke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 131 days
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 131 days
jeffsmithpwm.ca jeffsmithpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 131 days
kenwardgrouppwm.com kenwardgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 193 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
kucherawyandassociates.ca kucherawyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Apr 2023 Apr 2023 One Off
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 134 days
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 75 days
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 188 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 61 days
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 141 days
pentzwebsterandassociates.com pentzwebsterandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 180 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 143 days
philippedumont.com philippedumont.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 179 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 59 days
pompu.ca pompu.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 145 days
reishelpwm.com reishelpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 118 days
richardwutzke.com richardwutzke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
robeby.com robeby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
robeby.us1.advisor.ws robeby.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
runzerandassociates.com runzerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 116 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 65 days
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 362 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 143 days
santosandassociates.ca santosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 174 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 56 days
sharmaandassociatespwm.com sharmaandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
anna-marierasmussen.ca anna-marierasmussen.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Sep 2023 326 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 110 days
squireassociates.ca squireassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2023 102 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 83 days
stranskyandassociates.ca stranskyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 355 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 94 days
thlprivatewealth.com thlprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 350 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 97 days
toddandassociatespwm.com toddandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 125 days
bastgroup.ca bastgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 327 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 136 days
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 125 days
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Feb 2023 102 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Feb 2023 20 days
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 114 days
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 222 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 72 days
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Mar 2023 43 days
brunotherrien.ca brunotherrien.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
dalesmallgroup.ca dalesmallgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 316 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 119 days
deprezandassociates.com deprezandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 315 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 139 days
desfossesgoulet.ca desfossesgoulet.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 139 days
elaineandrewandassociates.com elaineandrewandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 141 days
equipejeanthomasmenard.com equipejeanthomasmenard.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 142 days
equipelaforme.com equipelaforme.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
equipelptoupin.ca equipelptoupin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
greghillaby.com greghillaby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 137 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 79 days
hallamandassociates.com hallamandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 300 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 127 days
hansonprivatewealth.ca hansonprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 145 days
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 131 days
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 132 days
jwrossandassociates.ca jwrossandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 132 days
kathyduguaypwm.com kathyduguaypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 193 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Jun 2023 125 days
leboeufpwm.com leboeufpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 134 days
loweandassociates.ca loweandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 136 days
macdougallandmaticpwm.com macdougallandmaticpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 283 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 136 days
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 136 days
marianasemenchuk.com marianasemenchuk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 146 days
mcinroypwm.com mcinroypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 187 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Jun 2023 113 days
methorstandassociates.ca methorstandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 138 days
mhmrpwm.ca mhmrpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 138 days
nolinandassociatespwm.com nolinandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jun 2023 242 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 141 days
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2023 6 days
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 363 days
scepanovicandassociates.com scepanovicandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
seeleyandshoemaker.com seeleyandshoemaker.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
simundsonandassociates.ca simundsonandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 172 days
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
bcbgestionprivee.com bcbgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 95 days
benkeandassociates.com benkeandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
brunotherrien.us1.advisor.ws brunotherrien.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Nov 2022 One Off
wolkerandassociatespwm.com wolkerandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
cameronrennieandassociates.com cameronrennieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 92 days
claudegallantigprivatewealthcom.us1.advisor.ws claudegallantigprivatewealthcom.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Dec 2022 One Off
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 89 days
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
davedesrochers.ca davedesrochers.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 145 days
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2022 56 days
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2022 56 days
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2022 56 days
freemangroup.us1.advisor.ws freemangroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2022 60 days
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2022 72 days
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 132 days
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 327 days
markewert.com markewert.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 188 days
metzgergroup.ca metzgergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 69 days
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
freemangroup.ca freemangroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 194 days
kcmprivatewealth.ca kcmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 74 days
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
leavittgroup.ca leavittgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
markewert.us1.advisor.ws markewert.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
millarddawes.com millarddawes.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
nolintoogood.ca nolintoogood.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 66 days
nturner.us1.advisor.ws nturner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 96 days
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 97 days
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
spenceandassociatespwm.com spenceandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 48 days
walshmckenziedegroot.com walshmckenziedegroot.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 47 days
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 343 days
claudegallantandassociates.com claudegallantandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
gibbingsandassociates.com gibbingsandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2022 72 days
greengrouppwm.com greengrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 201 days
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
fayeafshar.com fayeafshar.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
marcovendramini.com marcovendramini.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 71 days
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
rawlukprivatewealth.com rawlukprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 363 days
rspence.us1.advisor.ws rspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 362 days
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
scottsyrja.com scottsyrja.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 360 days
taylorzapotoczny.com taylorzapotoczny.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
themorristeam.ca themorristeam.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 316 days
davidhames.ca davidhames.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
dhames.us1.advisor.ws dhames.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
donfox.us1.advisor.ws donfox.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
equipegilbertpereira.com equipegilbertpereira.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
esserprivatewealth.com esserprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
floerfarrowpwm.com floerfarrowpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Sep 2023 341 days
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2022 59 days
foxrevettassociates.com foxrevettassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2022 60 days
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2022 62 days
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
johncornwallandassociates.com johncornwallandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2022 72 days
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
lacassedelarierafr.us1.advisor.ws lacassedelarierafr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 76 days
larmandgroup.com larmandgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
lylekarasick.com lylekarasick.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 82 days
mabeeandassociatespwm.com mabeeandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 83 days
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 69 days
naultgrouppwm.ca naultgrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
bayandassociates.ca bayandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 327 days
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
syrja.ca syrja.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
lacassedelariera.com lacassedelariera.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
karenandkayla.ca karenandkayla.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
dennishuntandassociates.ca dennishuntandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
gobelandassociates.com gobelandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
paulvaillancourt.com fr.paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Jan 2023 Feb 2023 30 days
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 129 days
robdaumler.com robdaumler.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 360 days
sifnakisgroup.com sifnakisgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 114 days
thomassavage.ca thomassavage.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 105 days
wheelermcivor.ca wheelermcivor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 47 days
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 92 days
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2023 One Off
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2023 Oct 2023 29 days
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
elevateyourwealth.ca elevateyourwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 142 days
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
gaylortachauer.ca gaylortachauer.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Dec 2022 67 days
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
lalliandassociates.com lalliandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 351 days
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 89 days
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
osmondfindlay.ca osmondfindlay.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2023 4 days
paulvaillancourt.com paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
rapwm.com rapwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
kapwm.ca kapwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 292 days
daviesmahnke.com daviesmahnke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
donnellygrouppwm.com donnellygrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
geeandassociates.ca geeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
dawsonandassociatespwm.com dawsonandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
RASMUSSENASSOCIATES.US1.ADVISOR.WS
Non IP Attributes
Attribute First Last
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023
RASMUSSENASSOCIATES.US1.ADVISOR.WS
Overlap Attribute Domains
kudrowichpwm.com kudrowichpwm.com
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
loretoryder.com loretoryder.com
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
mehrotragroup.com mehrotragroup.com
mertenswealth.com mertenswealth.com
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
mielefinancialgroup.ca mielefinancialgroup.ca
nathalygagnon.com nathalygagnon.com
paziukandassociates.com paziukandassociates.com
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
rickdellpwm.com rickdellpwm.com
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
agrawalassociates.ca agrawalassociates.ca
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
sylvielefebvre.com sylvielefebvre.com
thekilgourgroup.com thekilgourgroup.com
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
tobacpwm.com tobacpwm.com
trudybuttandassociates.com trudybuttandassociates.com
vignoneassociatespwm.com vignoneassociatespwm.com
bourgeaultandassociates.com bourgeaultandassociates.com
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
buhrblaylock.com buhrblaylock.com
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
zarnlochheadpwm.com zarnlochheadpwm.com
chiodobirkettandassociates.com chiodobirkettandassociates.com
chmprivatewealth.ca chmprivatewealth.ca
claudegallant.com claudegallant.com
courcellesgroup.com courcellesgroup.com
equipedaoust.ca equipedaoust.ca
equipemicheldesbiens.com equipemicheldesbiens.com
farrowandassociatespwm.com farrowandassociatespwm.com
finchgoodale.com finchgoodale.com
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
floermillikengroup.com floermillikengroup.com
garofaloandassociates.ca garofaloandassociates.ca
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
jeffsomerspwm.com jeffsomerspwm.com
jenningsandassociates.ca jenningsandassociates.ca
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
juddbissonandassociates.com juddbissonandassociates.com
kalinkaprivatewealth.com kalinkaprivatewealth.com
karasickprivatewealth.com karasickprivatewealth.com
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
kevinkaiser.ca kevinkaiser.ca
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
landriaultpwm.com landriaultpwm.com
lehouxgestionprivee.com lehouxgestionprivee.com
lisabell.ca lisabell.ca
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
loboandassociatespwm.ca loboandassociatespwm.ca
macmahonandassociates.com macmahonandassociates.com
mignaultprivatewealth.com mignaultprivatewealth.com
milngroup.com milngroup.com
mondouetassocies.com mondouetassocies.com
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
peterdefrancesco.com peterdefrancesco.com
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
powellpwm.com powellpwm.com
princeandassociates.ca princeandassociates.ca
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
ryangroupwealth.com ryangroupwealth.com
schillerspence.ca schillerspence.ca
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
snowandassociatespwm.com snowandassociatespwm.com
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
stevenboydpwm.com stevenboydpwm.com
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
vickendurgerian.com vickendurgerian.com
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
brodieandassociates.com brodieandassociates.com
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
carneylyster.com carneylyster.com
carterprivatewealth.com carterprivatewealth.com
charbonneauetassocies.ca charbonneauetassocies.ca
colbournegroup.com colbournegroup.com
coleentaylor.ca coleentaylor.ca
dehartandassociates.com dehartandassociates.com
donfox.net donfox.net
edbootle.ca edbootle.ca
elliottchaulk.com elliottchaulk.com
equipetremblay.com equipetremblay.com
gabechiodo.ca gabechiodo.ca
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
ginettebradette.ca ginettebradette.ca
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
harveypwm.ca harveypwm.ca
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
irenevassalo.com irenevassalo.com
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
jasondaleo.ca jasondaleo.ca
jennerandassociates.com jennerandassociates.com
jenningsgroup.ca jenningsgroup.ca
johnmazziotti.com johnmazziotti.com
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
roesthovesquire.ca roesthovesquire.ca
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
sylvainmorin.ca sylvainmorin.ca
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
thiessenpwm.com thiessenpwm.com
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
tmassociates.ca tmassociates.ca
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
blackbelyea.com blackbelyea.com
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
wannerandassociates.ca wannerandassociates.ca
brentmacdonald.ca brentmacdonald.ca
wherryandassociates.ca wherryandassociates.ca
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
woodwardandassociates.ca woodwardandassociates.ca
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
costantinigroup.ca costantinigroup.ca
dallaireandassociates.ca dallaireandassociates.ca
danylukandassociates.com danylukandassociates.com
ddkpwm.ca ddkpwm.ca
dupuispwm.com dupuispwm.com
equipealainbrunet.com equipealainbrunet.com
equipemarcantoinereid.com equipemarcantoinereid.com
equipesimonaube.com equipesimonaube.com
equipeyanickjuneau.ca equipeyanickjuneau.ca
flanaganandassociates.ca flanaganandassociates.ca
gerberteam.com gerberteam.com
girardandassociates.com girardandassociates.com
godwinandassociates.ca godwinandassociates.ca
hoffmangrouppwm.ca hoffmangrouppwm.ca
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
jasonblucke.com jasonblucke.com
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
jeffsmithpwm.ca jeffsmithpwm.ca
kenwardgrouppwm.com kenwardgrouppwm.com
kucherawyandassociates.ca kucherawyandassociates.ca
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
pentzwebsterandassociates.com pentzwebsterandassociates.com
philippedumont.com philippedumont.com
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
pompu.ca pompu.ca
reishelpwm.com reishelpwm.com
richardwutzke.com richardwutzke.com
robeby.com robeby.com
robeby.us1.advisor.ws robeby.us1.advisor.ws
runzerandassociates.com runzerandassociates.com
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
santosandassociates.ca santosandassociates.ca
sharmaandassociatespwm.com sharmaandassociatespwm.com
anna-marierasmussen.ca anna-marierasmussen.ca
squireassociates.ca squireassociates.ca
stranskyandassociates.ca stranskyandassociates.ca
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
thlprivatewealth.com thlprivatewealth.com
toddandassociatespwm.com toddandassociatespwm.com
bastgroup.ca bastgroup.ca
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
brunotherrien.ca brunotherrien.ca
dalesmallgroup.ca dalesmallgroup.ca
deprezandassociates.com deprezandassociates.com
desfossesgoulet.ca desfossesgoulet.ca
elaineandrewandassociates.com elaineandrewandassociates.com
equipejeanthomasmenard.com equipejeanthomasmenard.com
equipelaforme.com equipelaforme.com
equipelptoupin.ca equipelptoupin.ca
greghillaby.com greghillaby.com
hallamandassociates.com hallamandassociates.com
hansonprivatewealth.ca hansonprivatewealth.ca
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
jwrossandassociates.ca jwrossandassociates.ca
kathyduguaypwm.com kathyduguaypwm.com
leboeufpwm.com leboeufpwm.com
loweandassociates.ca loweandassociates.ca
macdougallandmaticpwm.com macdougallandmaticpwm.com
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
marianasemenchuk.com marianasemenchuk.com
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
mcinroypwm.com mcinroypwm.com
methorstandassociates.ca methorstandassociates.ca
mhmrpwm.ca mhmrpwm.ca
nolinandassociatespwm.com nolinandassociatespwm.com
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
scepanovicandassociates.com scepanovicandassociates.com
seeleyandshoemaker.com seeleyandshoemaker.com
simundsonandassociates.ca simundsonandassociates.ca
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
bcbgestionprivee.com bcbgestionprivee.com
benkeandassociates.com benkeandassociates.com
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
brunotherrien.us1.advisor.ws brunotherrien.us1.advisor.ws
wolkerandassociatespwm.com wolkerandassociatespwm.com
cameronrennieandassociates.com cameronrennieandassociates.com
claudegallantigprivatewealthcom.us1.advisor.ws claudegallantigprivatewealthcom.us1.advisor.ws
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
davedesrochers.ca davedesrochers.ca
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
freemangroup.us1.advisor.ws freemangroup.us1.advisor.ws
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
markewert.com markewert.com
metzgergroup.ca metzgergroup.ca
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
freemangroup.ca freemangroup.ca
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
kcmprivatewealth.ca kcmprivatewealth.ca
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
leavittgroup.ca leavittgroup.ca
markewert.us1.advisor.ws markewert.us1.advisor.ws
millarddawes.com millarddawes.com
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
nolintoogood.ca nolintoogood.ca
nturner.us1.advisor.ws nturner.us1.advisor.ws
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
spenceandassociatespwm.com spenceandassociatespwm.com
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
walshmckenziedegroot.com walshmckenziedegroot.com
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
claudegallantandassociates.com claudegallantandassociates.com
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
gibbingsandassociates.com gibbingsandassociates.com
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
greengrouppwm.com greengrouppwm.com
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
fayeafshar.com fayeafshar.com
marcovendramini.com marcovendramini.com
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
rawlukprivatewealth.com rawlukprivatewealth.com
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
rspence.us1.advisor.ws rspence.us1.advisor.ws
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
scottsyrja.com scottsyrja.com
taylorzapotoczny.com taylorzapotoczny.com
themorristeam.ca themorristeam.ca
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
davidhames.ca davidhames.ca
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
dhames.us1.advisor.ws dhames.us1.advisor.ws
donfox.us1.advisor.ws donfox.us1.advisor.ws
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
equipegilbertpereira.com equipegilbertpereira.com
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
esserprivatewealth.com esserprivatewealth.com
floerfarrowpwm.com floerfarrowpwm.com
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
foxrevettassociates.com foxrevettassociates.com
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
johncornwallandassociates.com johncornwallandassociates.com
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
lacassedelarierafr.us1.advisor.ws lacassedelarierafr.us1.advisor.ws
larmandgroup.com larmandgroup.com
lylekarasick.com lylekarasick.com
mabeeandassociatespwm.com mabeeandassociatespwm.com
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
naultgrouppwm.ca naultgrouppwm.ca
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
bayandassociates.ca bayandassociates.ca
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
syrja.ca syrja.ca
lacassedelariera.com lacassedelariera.com
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
karenandkayla.ca karenandkayla.ca
dennishuntandassociates.ca dennishuntandassociates.ca
gobelandassociates.com gobelandassociates.com
fr.paulvaillancourt.com fr.paulvaillancourt.com
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
robdaumler.com robdaumler.com
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
sifnakisgroup.com sifnakisgroup.com
thomassavage.ca thomassavage.ca
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
wheelermcivor.ca wheelermcivor.ca
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
elevateyourwealth.ca elevateyourwealth.ca
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
gaylortachauer.ca gaylortachauer.ca
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
lalliandassociates.com lalliandassociates.com
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
osmondfindlay.ca osmondfindlay.ca
paulvaillancourt.com paulvaillancourt.com
rapwm.com rapwm.com
kapwm.ca kapwm.ca
daviesmahnke.com daviesmahnke.com
donnellygrouppwm.com donnellygrouppwm.com
geeandassociates.ca geeandassociates.ca
dawsonandassociatespwm.com dawsonandassociatespwm.com
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
RASMUSSENASSOCIATES.US1.ADVISOR.WS
IP History

Click the IP addresses to see over domains using them.