DALLAIREANDASSOCIATES.CA
Shared Attributes
Domain
mielefinancialgroup.ca mielefinancialgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 266 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 192 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
agrawalassociates.ca agrawalassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Feb 2025 2 years, 81 days
GTM GTM-G-0FSFL4QW1Q Aug 2022 May 2023 257 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
farrowandassociatespwm.com farrowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 300 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 188 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
freemangroup.ca freemangroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 281 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Dec 2022 96 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
loboandassociatespwm.ca loboandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 28 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
equipemarcantoinereid.com equipemarcantoinereid.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 301 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 204 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
godwinandassociates.ca godwinandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 287 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 261 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 118 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 94 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
jwrossandassociates.ca jwrossandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Feb 2025 2 years, 132 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 190 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
loweandassociates.ca loweandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 263 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 156 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 254 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 254 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
marianasemenchuk.com marianasemenchuk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 253 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Jun 2023 253 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
kudrowichpwm.com kudrowichpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2024 2 years, 204 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 190 days
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 263 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 191 days
loretoryder.com loretoryder.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 263 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2024 2 years, 6 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 155 days
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 253 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 324 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Oct 2022 One Off
mehrotragroup.com mehrotragroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
mertenswealth.com mertenswealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 266 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 192 days
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2025 2 years, 130 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Jun 2023 253 days
paziukandassociates.com paziukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2024 1 year, 360 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Jun 2023 245 days
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 291 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
rickdellpwm.com rickdellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 127 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 187 days
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Sep 2024 1 year, 334 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Aug 2024 2 years, 64 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Jun 2023 238 days
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Sep 2024 2 years, 108 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 134 days
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2023 101 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
sylvielefebvre.com sylvielefebvre.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 May 2023 185 days
thekilgourgroup.com thekilgourgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 140 days
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 180 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
tobacpwm.com tobacpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 184 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
bcbgestionprivee.com bcbgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Nov 2024 1 year, 118 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Nov 2022 One Off
trudybuttandassociates.com trudybuttandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 184 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
benkeandassociates.com benkeandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Apr 2024 2 years, 2 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Nov 2022 One Off
vignoneassociatespwm.com vignoneassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 114 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 207 days
bourgeaultandassociates.com bourgeaultandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 305 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 46 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 188 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Nov 2022 One Off
brunotherrien.us1.advisor.ws brunotherrien.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Nov 2022 Nov 2022 One Off
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Nov 2022 One Off
buhrblaylock.com buhrblaylock.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 305 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 210 days
wolkerandassociatespwm.com wolkerandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 184 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Nov 2022 One Off
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Aug 2024 1 year, 292 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 180 days
zarnlochheadpwm.com zarnlochheadpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2024 1 year, 155 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 38 days
chiodobirkettandassociates.com chiodobirkettandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2023 337 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Mar 2023 128 days
chmprivatewealth.ca chmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Feb 2025 2 years, 166 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 186 days
claudegallant.com claudegallant.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 90 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 168 days
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 306 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
courcellesgroup.com courcellesgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 306 days
GTM GTM-G-0FSFL4QW1Q Aug 2022 May 2023 266 days
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipedaoust.ca equipedaoust.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Feb 2025 1 year, 323 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 66 days
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipemicheldesbiens.com equipemicheldesbiens.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 301 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 188 days
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2022 241 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
finchgoodale.com finchgoodale.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Feb 2025 1 year, 256 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2023 343 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Mar 2023 101 days
floermillikengroup.com floermillikengroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 144 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 181 days
garofaloandassociates.ca garofaloandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 83 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 275 days
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 82 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 201 days
jeffsomerspwm.com jeffsomerspwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Aug 2023 1 year, 81 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 190 days
jenningsandassociates.ca jenningsandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Apr 2023 327 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 265 days
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 265 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 161 days
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2022 229 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Dec 2022 97 days
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jul 2024 1 year, 293 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 160 days
dargisgroup.ca dargisgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 205 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
metzgergroup.ca metzgergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Feb 2025 1 year, 185 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
daumlermertzwealth.ca daumlermertzwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2024 Feb 2025 78 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
mauriziomastroianni.com mauriziomastroianni.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Feb 2025 271 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
juddbissonandassociates.com juddbissonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 265 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 190 days
kalinkaprivatewealth.com kalinkaprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Feb 2025 1 year, 240 days
GTM GTM-G-0FSFL4QW1Q Jun 2023 Jun 2023 7 days
karasickprivatewealth.com karasickprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 278 days
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jun 2023 256 days
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jul 2024 1 year, 301 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 256 days
kevinkaiser.ca kevinkaiser.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2024 2 years, 202 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 263 days
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 60 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 159 days
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 79 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 160 days
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 264 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 190 days
landriaultpwm.com landriaultpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jan 2025 1 year, 296 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 64 days
lehouxgestionprivee.com lehouxgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 264 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 191 days
lisabell.ca lisabell.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Apr 2023 329 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 130 days
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Apr 2023 193 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 95 days
macmahonandassociates.com macmahonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jun 2023 254 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
mignaultprivatewealth.com mignaultprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 19 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 192 days
milngroup.com milngroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 259 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 193 days
mondouetassocies.com mondouetassocies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 321 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 193 days
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 May 2024 1 year, 225 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 90 days
peterdefrancesco.com peterdefrancesco.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 131 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 189 days
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 139 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 100 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jun 2024 1 year, 240 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Jun 2023 244 days
powellpwm.com powellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 130 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 189 days
princeandassociates.ca princeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 256 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 141 days
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Aug 2024 2 years, 64 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Sep 2024 2 years, 106 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
ryangroupwealth.com ryangroupwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2024 1 year, 353 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 186 days
schillerspence.ca schillerspence.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 250 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 149 days
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2024 1 year, 311 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 134 days
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 194 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
snowandassociatespwm.com snowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 122 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 185 days
spenceandassociatespwm.com spenceandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Oct 2022 One Off
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2024 2 years, 172 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Apr 2023 83 days
stevenboydpwm.com stevenboydpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 184 days
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 141 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 81 days
vickendurgerian.com vickendurgerian.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2024 1 year, 158 days
GTM GTM-G-0FSFL4QW1Q May 2023 Jun 2023 26 days
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2023 Jul 2024 1 year, 135 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 78 days
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 47 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 May 2024 1 year, 180 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 174 days
brodieandassociates.com brodieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 305 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 210 days
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 188 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
carneylyster.com carneylyster.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 296 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 186 days
carterprivatewealth.com carterprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 306 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 208 days
charbonneauetassocies.ca charbonneauetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Feb 2025 2 years, 166 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 207 days
colbournegroup.com colbournegroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Feb 2025 1 year, 332 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 147 days
coleentaylor.ca coleentaylor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Feb 2025 2 years, 164 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 206 days
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Nov 2023 1 year, 226 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 128 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 128 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
dehartandassociates.com dehartandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 306 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 May 2023 266 days
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 88 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
donfox.net donfox.net
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 291 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 188 days
edbootle.ca edbootle.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 303 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 204 days
elliottchaulk.com elliottchaulk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 302 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 204 days
equipetremblay.com equipetremblay.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 301 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 204 days
gabechiodo.ca gabechiodo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jan 2025 1 year, 255 days
GTM GTM-G-0FSFL4QW1Q May 2023 Jun 2023 36 days
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 54 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
ginettebradette.ca ginettebradette.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 233 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 274 days
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 285 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Mar 2023 100 days
harveypwm.ca harveypwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 138 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 190 days
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 79 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 162 days
irenevassalo.com irenevassalo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 282 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 189 days
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2024 2 years, 9 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 257 days
jasondaleo.ca jasondaleo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 260 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 71 days
jennerandassociates.com jennerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 265 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 190 days
jenningsgroup.ca jenningsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 265 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 198 days
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 May 2024 1 year, 243 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Sep 2022 One Off
johnmazziotti.com johnmazziotti.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 265 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 198 days
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Feb 2025 2 years, 132 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 160 days
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
mariodufouretassociees.ca mariodufouretassociees.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 214 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
hopkinspopeandassociates.ca hopkinspopeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 210 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 139 days
roesthovesquire.ca roesthovesquire.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 162 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 46 days
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 139 days
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jun 2024 1 year, 228 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Jun 2023 230 days
sylvainmorin.ca sylvainmorin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 183 days
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 64 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 May 2023 185 days
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Oct 2022 May 2023 185 days
SC SC-INVESTORSGRIG.COMPROD Oct 2022 May 2023 185 days
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 179 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 81 days
thiessenpwm.com thiessenpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 211 days
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Jul 2024 1 year, 224 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Mar 2023 102 days
tmassociates.ca tmassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 184 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 182 days
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 80 days
blackbelyea.com blackbelyea.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2022 Feb 2025 2 years, 207 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Mar 2023 101 days
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2024 1 year, 336 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
wannerandassociates.ca wannerandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 187 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 207 days
brentmacdonald.ca brentmacdonald.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 305 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 186 days
wherryandassociates.ca wherryandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 188 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 206 days
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 86 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 181 days
woodwardandassociates.ca woodwardandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 184 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 217 days
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 127 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 197 days
costantinigroup.ca costantinigroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 306 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 206 days
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Jun 2024 1 year, 182 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
danylukandassociates.com danylukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Feb 2025 2 years, 163 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 206 days
davidhames.ca davidhames.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
GTM GTM-G-0FSFL4QW1Q Aug 2022 Aug 2022 One Off
ddkpwm.ca ddkpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 149 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 206 days
donfox.us1.advisor.ws donfox.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 58 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
dupuispwm.com dupuispwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Feb 2025 2 years, 63 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 186 days
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 87 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Dec 2022 96 days
equipealainbrunet.com equipealainbrunet.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 301 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 184 days
equipesimonaube.com equipesimonaube.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 301 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 204 days
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 59 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipeyanickjuneau.ca equipeyanickjuneau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 301 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 184 days
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 86 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Sep 2022 One Off
esserprivatewealth.com esserprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 301 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Sep 2022 One Off
flanaganandassociates.ca flanaganandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 232 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 May 2023 262 days
floerfarrowpwm.com floerfarrowpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2023 1 year, 158 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Dec 2022 96 days
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Sep 2022 Dec 2022 96 days
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2022 242 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 142 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Dec 2022 96 days
gerberteam.com gerberteam.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 288 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 202 days
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
girardandassociates.com girardandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 141 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 178 days
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
hoffmangrouppwm.ca hoffmangrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 284 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 189 days
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2024 2 years, 9 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 161 days
jasonblucke.com jasonblucke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Feb 2025 2 years, 133 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 272 days
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 265 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 190 days
jeffsmithpwm.ca jeffsmithpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Feb 2025 2 years, 133 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 257 days
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2022 229 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 60 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Dec 2022 96 days
kenwardgrouppwm.com kenwardgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2024 1 year, 239 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 197 days
kucherawyandassociates.ca kucherawyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 264 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Apr 2023 One Off
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 59 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 159 days
lylekarasick.com lylekarasick.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jan 2023 119 days
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2023 99 days
marcovendramini.com marcovendramini.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 126 days
SC SC-INVESTORSGRIG.COMPROD Dec 2024 Dec 2024 One Off
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 99 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jun 2024 1 year, 267 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 155 days
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jun 2024 1 year, 75 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 61 days
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 39 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Jun 2023 254 days
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 318 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Jun 2023 253 days
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2024 1 year, 244 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 149 days
pentzwebsterandassociates.com pentzwebsterandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 170 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 152 days
philippedumont.com philippedumont.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 131 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 189 days
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 12 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 144 days
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Sep 2024 1 year, 142 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 54 days
pompu.ca pompu.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 251 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Jun 2023 242 days
foxrevettassociates.com foxrevettassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 288 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
reishelpwm.com reishelpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 127 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 166 days
richardwutzke.com richardwutzke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 127 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 187 days
robeby.com robeby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Jan 2025 2 years, 239 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Jun 2023 238 days
robeby.us1.advisor.ws robeby.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Jan 2025 2 years, 239 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
runzerandassociates.com runzerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2024 1 year, 107 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 58 days
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Sep 2024 1 year, 334 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 136 days
santosandassociates.ca santosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 165 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 49 days
sharmaandassociatespwm.com sharmaandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 185 days
anna-marierasmussen.ca anna-marierasmussen.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2023 1 year, 152 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 184 days
squireassociates.ca squireassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 128 days
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2023 102 days
stranskyandassociates.ca stranskyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 184 days
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2024 1 year, 347 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 139 days
thlprivatewealth.com thlprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2024 1 year, 342 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 140 days
thomassavage.ca thomassavage.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Nov 2022 One Off
toddandassociatespwm.com toddandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 184 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 211 days
bastgroup.ca bastgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Feb 2025 2 years, 75 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 199 days
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 65 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 202 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Nov 2022 Feb 2023 102 days
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Feb 2023 102 days
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 46 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 174 days
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 120 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 72 days
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2022 Nov 2024 2 years, 109 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Mar 2023 103 days
brunotherrien.ca brunotherrien.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 305 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 210 days
dalesmallgroup.ca dalesmallgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Feb 2025 2 years, 67 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 186 days
dawsonandassociatespwm.com dawsonandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 306 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Sep 2022 One Off
deprezandassociates.com deprezandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Feb 2025 2 years, 66 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 190 days
desfossesgoulet.ca desfossesgoulet.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Feb 2025 2 years, 162 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 205 days
donnellygrouppwm.com donnellygrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 304 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Sep 2022 One Off
elaineandrewandassociates.com elaineandrewandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 302 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 204 days
equipejeanthomasmenard.com equipejeanthomasmenard.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Feb 2025 2 years, 156 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 204 days
equipelaforme.com equipelaforme.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 301 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 204 days
equipelptoupin.ca equipelptoupin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Feb 2025 2 years, 156 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 280 days
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 61 days
GTM GTM-G-0FSFL4QW1Q Sep 2022 Sep 2022 One Off
greghillaby.com greghillaby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Jan 2025 1 year, 244 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 74 days
hallamandassociates.com hallamandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Jan 2025 2 years, 42 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 189 days
hansonprivatewealth.ca hansonprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 285 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 201 days
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 May 2024 1 year, 243 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 161 days
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 68 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 160 days
kathyduguaypwm.com kathyduguaypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Feb 2025 1 year, 301 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Jun 2023 118 days
leboeufpwm.com leboeufpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Feb 2025 2 years, 128 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jun 2023 191 days
macdougallandmaticpwm.com macdougallandmaticpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 188 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 39 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Jun 2023 253 days
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 40 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 155 days
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 264 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 156 days
mcinroypwm.com mcinroypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Feb 2025 1 year, 301 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Jun 2023 113 days
methorstandassociates.ca methorstandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 267 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 155 days
mhmrpwm.ca mhmrpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 266 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 192 days
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 303 days
GTM GTM-G-0FSFL4QW1Q Oct 2022 Oct 2022 One Off
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 99 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
nolinandassociatespwm.com nolinandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2023 1 year, 23 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 153 days
angelomanzo.com angelomanzo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 309 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
hagueandassociates.ca hagueandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Jan 2025 135 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
kapwm.ca kapwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Jan 2025 2 years, 29 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
jesseharris.ca jesseharris.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2023 Feb 2025 1 year, 42 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
geeandassociates.ca geeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 287 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
groupeberardinelli.com groupeberardinelli.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 270 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
nathalygagnon.com fr.nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jan 2023 38 days
larouchepwm.ca larouchepwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Feb 2025 167 days
lovisandassociates.com lovisandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Sep 2022 137 days
nathalygagnon.com nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 136 days
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 May 2024 226 days
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 291 days
sajoetassocies.ca sajoetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Oct 2024 13 days
salsbury.ca salsbury.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2024 Oct 2024 238 days
scepanovicandassociates.com scepanovicandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 125 days
seeleyandshoemaker.com seeleyandshoemaker.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 139 days
sharifosterandassociates.ca sharifosterandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Oct 2024 119 days
simundsonandassociates.ca simundsonandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 163 days
slaunwhiteandassociates.ca slaunwhiteandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Oct 2024 99 days
stephenstruthers.us1.advisor.ws stephenstruthers.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Aug 2024 97 days
stevensandassociates.ca stevensandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 351 days
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 64 days
baileyassociates.ca baileyassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Feb 2025 262 days
beaulieulebuis.com beaulieulebuis.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 302 days
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2024 1 year, 332 days
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 89 days
cameronrennieandassociates.com cameronrennieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Feb 2025 1 year, 206 days
claudegallantigprivatewealthcom.us1.advisor.ws claudegallantigprivatewealthcom.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Dec 2022 One Off
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Aug 2024 1 year, 26 days
davedesrochers.ca davedesrochers.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Feb 2025 1 year, 261 days
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 56 days
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 128 days
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 125 days
fredpentz.us1.advisor.ws fredpentz.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jan 2025 252 days
freemangroup.us1.advisor.ws freemangroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
gagrawal.us1.advisor.ws gagrawal.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 93 days
garofalodonato.ca garofalodonato.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Jan 2025 167 days
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 287 days
hopeandassociates.ca hopeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2022 147 days
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 282 days
jonathandaviespwm.ca jonathandaviespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 275 days
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 69 days
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Dec 2023 201 days
kennedyassociateswm.us1.advisor.ws kennedyassociateswm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 112 days
krallwilliamsgroup.ca krallwilliamsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2025 Feb 2025 One Off
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Feb 2025 2 years, 75 days
anjalijensen.com anjalijensen.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 309 days
markewert.com markewert.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jan 2025 1 year, 289 days
equipesoniagosselin.ca equipesoniagosselin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Feb 2025 110 days
bowtellandassociate.ca bowtellandassociate.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Feb 2025 110 days
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 304 days
canningandpoolegroup.ca canningandpoolegroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Feb 2025 216 days
chevaliermccorristonandassociates.ca chevaliermccorristonandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2025 Feb 2025 10 days
cheungprivatewealth.ca cheungprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2025 Feb 2025 One Off
chsmwealth.ca chsmwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Feb 2025 254 days
igfr.us1.advisor.ws igfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Sep 2022 Dec 2022 96 days
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 107 days
kcmprivatewealth.ca kcmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Feb 2025 1 year, 182 days
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
leavittgroup.ca leavittgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 264 days
lerouxpepin.ca lerouxpepin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Feb 2025 135 days
markewert.us1.advisor.ws markewert.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 39 days
millarddawes.com millarddawes.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2024 1 year, 239 days
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 320 days
nolintoogood.ca nolintoogood.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2024 1 year, 55 days
nturner.us1.advisor.ws nturner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Sep 2024 2 years, 121 days
paughcarlsonwealth.ca paughcarlsonwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Sep 2024 88 days
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 May 2024 1 year, 225 days
potvinlemayetassocies.ca potvinlemayetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Oct 2024 13 days
samuelswealth.ca samuelswealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Oct 2024 13 days
seeleygroup.ca seeleygroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 353 days
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Nov 2023 121 days
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 38 days
stephenjudd.us1.advisor.ws stephenjudd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Sep 2024 148 days
taylorzapotoczny.us1.advisor.ws taylorzapotoczny.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Jun 2022 One Off
beginbattinggroup.ca beginbattinggroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Feb 2025 276 days
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2024 1 year, 335 days
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Mar 2024 194 days
vinerandselig.ca vinerandselig.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Oct 2024 100 days
walshmckenziedegroot.com walshmckenziedegroot.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2024 1 year, 43 days
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2024 1 year, 340 days
gallantgrouppwm.com fr.gallantgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Nov 2024 50 days
clairehallam.us1.advisor.ws clairehallam.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 110 days
claudegallantandassociates.com claudegallantandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 90 days
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 128 days
desrochersassociates.us1.advisor.ws desrochersassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jun 2024 40 days
equipelangevin.ca equipelangevin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2024 Feb 2025 63 days
equipeyl.ca equipeyl.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 288 days
gibbingsandassociates.com gibbingsandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 287 days
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2024 2 years, 10 days
mcgrathandassociateswm.com mcgrathandassociateswm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 226 days
equipetgt.ca equipetgt.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Feb 2025 131 days
greengrouppwm.com greengrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jan 2025 1 year, 308 days
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 287 days
huebertandassociates.com huebertandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 279 days
clayfung.ca clayfung.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Feb 2025 1 year, 82 days
anholtgroup.ca anholtgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Feb 2025 1 year, 89 days
michelleboeuf.us1.advisor.ws michelleboeuf.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 285 days
fayeafshar.com fayeafshar.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 300 days
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Sep 2024 1 year, 334 days
rawlukprivatewealth.com rawlukprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 127 days
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 291 days
rspence.us1.advisor.ws rspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2024 1 year, 353 days
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Sep 2024 2 years, 108 days
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Aug 2024 2 years, 81 days
scottsyrja.com scottsyrja.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jun 2024 1 year, 232 days
alonsoyuffeandassociates.ca alonsoyuffeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Feb 2025 178 days
spencelockiegroup.ca spencelockiegroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Oct 2024 147 days
taylorzapotoczny.com taylorzapotoczny.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
themorristeam.ca themorristeam.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
wiartpearsonakle.com wiartpearsonakle.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Oct 2024 162 days
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 56 days
dhames.us1.advisor.ws dhames.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 89 days
duanerunzer.us1.advisor.ws duanerunzer.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 110 days
equipeannegrypinich.ca equipeannegrypinich.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2025 Feb 2025 36 days
equipegilbertpereira.com equipegilbertpereira.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 126 days
gobelandassociates.com gobelandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 287 days
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 71 days
hopebirkettdawson.ca hopebirkettdawson.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 185 days
kboudreauandassociates.ca kboudreauandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Feb 2025 185 days
johncornwallandassociates.com johncornwallandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 265 days
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 265 days
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 69 days
karlchoquettegestionprivee.ca karlchoquettegestionprivee.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 241 days
kjonesandassociates.ca kjonesandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2022 One Off
lacassedelarierafr.us1.advisor.ws lacassedelarierafr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2023 97 days
larmandgroup.com larmandgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 264 days
mabeeandassociatespwm.com mabeeandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2024 1 year, 230 days
mastroianniassociatespwm.us1.advisor.ws mastroianniassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 114 days
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 May 2024 288 days
millardwealth.com millardwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 285 days
naultgrouppwm.ca naultgrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 136 days
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Aug 2024 2 years, 97 days
osmondfindlay.us1.advisor.ws osmondfindlay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2024 May 2024 118 days
bayandassociates.ca bayandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Feb 2025 2 years, 75 days
berardinelligroup.com berardinelligroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 302 days
amandagraham-rowe.com amandagraham-rowe.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Feb 2025 265 days
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 305 days
mignaultbadder.ca mignaultbadder.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Feb 2025 191 days
bouwmeestergroup.ca bouwmeestergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 299 days
syrja.ca syrja.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 302 days
dumitruflanaganandassociates.com dumitruflanaganandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 288 days
gallantgrouppwm.com gallantgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Jan 2025 167 days
markwebster.ca markwebster.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 271 days
lacassedelariera.com lacassedelariera.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 263 days
karenandkayla.ca karenandkayla.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Feb 2025 2 years, 264 days
dennishuntandassociates.ca dennishuntandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 306 days
dewashrafandassociates.ca dewashrafandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 252 days
paulvaillancourt.com fr.paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Feb 2023 81 days
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Sep 2022 Jun 2023 258 days
robdaumler.com robdaumler.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 127 days
saccoandassociates.ca saccoandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Oct 2024 44 days
sandraramosandassociates.ca sandraramosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 353 days
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2024 1 year, 115 days
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 352 days
sidarosetassocies.ca sidarosetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Oct 2024 134 days
sifnakisgroup.com sifnakisgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2024 1 year, 105 days
slaunwhiteassociates.us1.advisor.ws slaunwhiteassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Sep 2024 145 days
anholtgrouppwm.us1.advisor.ws anholtgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Aug 2024 98 days
backup002.us1.advisor.ws backup002.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jun 2024 30 days
vanderschuitlamb.ca vanderschuitlamb.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Oct 2024 99 days
wanandassociates.com wanandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Oct 2024 346 days
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Mar 2024 253 days
wheelermcivor.ca wheelermcivor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2024 1 year, 44 days
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Aug 2024 1 year, 28 days
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2023 One Off
csmprivatewealth.ca csmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Feb 2025 217 days
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2023 Aug 2024 332 days
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 88 days
elevateyourwealth.ca elevateyourwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Feb 2025 1 year, 258 days
engeviksaleskigroup.com engeviksaleskigroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Feb 2025 215 days
equipebenoitlauzon.ca equipebenoitlauzon.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 251 days
equipefrancismarleau.ca equipefrancismarleau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 251 days
evanriddell.com evanriddell.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2023 Aug 2024 259 days
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 33 days
gaylortachauer.ca gaylortachauer.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 288 days
halsimonson.ca halsimonson.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 278 days
jasonblucke.us1.advisor.ws jasonblucke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Feb 2025 135 days
kennedyassociates.ca kennedyassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2025 Feb 2025 One Off
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 74 days
lalliandassociates.com lalliandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 141 days
nasonandrose.ca nasonandrose.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Oct 2024 39 days
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Aug 2024 2 years, 92 days
osmondfindlay.ca osmondfindlay.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 358 days
paulvaillancourt.com paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 132 days
rapwm.com rapwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 138 days
hendriksprivatewealth.ca hendriksprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Jan 2025 100 days
mcclureandcassar.ca mcclureandcassar.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 225 days
daviesmahnke.com daviesmahnke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 306 days
equipestephanethibeault.ca equipestephanethibeault.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2024 Feb 2025 58 days
budhuandassociates.ca budhuandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 297 days
giannonejoncasetassocies.ca giannonejoncasetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 222 days
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025 2 years, 304 days
groupemanzo.com groupemanzo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 278 days
lyleandassociatespwm.ca lyleandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 214 days
dionetassocies.ca dionetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 252 days
DALLAIREANDASSOCIATES.CA
Non IP Attributes
Attribute First Last
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2025
GTM GTM-G-0FSFL4QW1Q Aug 2022 Jun 2023
SC SC-investorsgrig.comprod Jan 2025 Jan 2025
DALLAIREANDASSOCIATES.CA
Overlap Attribute Domains
mielefinancialgroup.ca mielefinancialgroup.ca
agrawalassociates.ca agrawalassociates.ca
farrowandassociatespwm.com farrowandassociatespwm.com
freemangroup.ca freemangroup.ca
loboandassociatespwm.ca loboandassociatespwm.ca
dallaireandassociates.ca dallaireandassociates.ca
equipemarcantoinereid.com equipemarcantoinereid.com
godwinandassociates.ca godwinandassociates.ca
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
jwrossandassociates.ca jwrossandassociates.ca
loweandassociates.ca loweandassociates.ca
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
marianasemenchuk.com marianasemenchuk.com
kudrowichpwm.com kudrowichpwm.com
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
loretoryder.com loretoryder.com
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
mehrotragroup.com mehrotragroup.com
mertenswealth.com mertenswealth.com
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
paziukandassociates.com paziukandassociates.com
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
rickdellpwm.com rickdellpwm.com
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
sylvielefebvre.com sylvielefebvre.com
thekilgourgroup.com thekilgourgroup.com
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
tobacpwm.com tobacpwm.com
bcbgestionprivee.com bcbgestionprivee.com
trudybuttandassociates.com trudybuttandassociates.com
benkeandassociates.com benkeandassociates.com
vignoneassociatespwm.com vignoneassociatespwm.com
bourgeaultandassociates.com bourgeaultandassociates.com
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
brunotherrien.us1.advisor.ws brunotherrien.us1.advisor.ws
buhrblaylock.com buhrblaylock.com
wolkerandassociatespwm.com wolkerandassociatespwm.com
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
zarnlochheadpwm.com zarnlochheadpwm.com
chiodobirkettandassociates.com chiodobirkettandassociates.com
chmprivatewealth.ca chmprivatewealth.ca
claudegallant.com claudegallant.com
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
courcellesgroup.com courcellesgroup.com
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
equipedaoust.ca equipedaoust.ca
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
equipemicheldesbiens.com equipemicheldesbiens.com
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
finchgoodale.com finchgoodale.com
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
floermillikengroup.com floermillikengroup.com
garofaloandassociates.ca garofaloandassociates.ca
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
jeffsomerspwm.com jeffsomerspwm.com
jenningsandassociates.ca jenningsandassociates.ca
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
dargisgroup.ca dargisgroup.ca
metzgergroup.ca metzgergroup.ca
daumlermertzwealth.ca daumlermertzwealth.ca
mauriziomastroianni.com mauriziomastroianni.com
juddbissonandassociates.com juddbissonandassociates.com
kalinkaprivatewealth.com kalinkaprivatewealth.com
karasickprivatewealth.com karasickprivatewealth.com
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
kevinkaiser.ca kevinkaiser.ca
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
landriaultpwm.com landriaultpwm.com
lehouxgestionprivee.com lehouxgestionprivee.com
lisabell.ca lisabell.ca
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
macmahonandassociates.com macmahonandassociates.com
mignaultprivatewealth.com mignaultprivatewealth.com
milngroup.com milngroup.com
mondouetassocies.com mondouetassocies.com
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
peterdefrancesco.com peterdefrancesco.com
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
powellpwm.com powellpwm.com
princeandassociates.ca princeandassociates.ca
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
ryangroupwealth.com ryangroupwealth.com
schillerspence.ca schillerspence.ca
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
snowandassociatespwm.com snowandassociatespwm.com
spenceandassociatespwm.com spenceandassociatespwm.com
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
stevenboydpwm.com stevenboydpwm.com
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
vickendurgerian.com vickendurgerian.com
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
brodieandassociates.com brodieandassociates.com
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
carneylyster.com carneylyster.com
carterprivatewealth.com carterprivatewealth.com
charbonneauetassocies.ca charbonneauetassocies.ca
colbournegroup.com colbournegroup.com
coleentaylor.ca coleentaylor.ca
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
dehartandassociates.com dehartandassociates.com
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
donfox.net donfox.net
edbootle.ca edbootle.ca
elliottchaulk.com elliottchaulk.com
equipetremblay.com equipetremblay.com
gabechiodo.ca gabechiodo.ca
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
ginettebradette.ca ginettebradette.ca
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
harveypwm.ca harveypwm.ca
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
irenevassalo.com irenevassalo.com
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
jasondaleo.ca jasondaleo.ca
jennerandassociates.com jennerandassociates.com
jenningsgroup.ca jenningsgroup.ca
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
johnmazziotti.com johnmazziotti.com
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
mariodufouretassociees.ca mariodufouretassociees.ca
hopkinspopeandassociates.ca hopkinspopeandassociates.ca
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
roesthovesquire.ca roesthovesquire.ca
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
sylvainmorin.ca sylvainmorin.ca
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
thiessenpwm.com thiessenpwm.com
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
tmassociates.ca tmassociates.ca
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
blackbelyea.com blackbelyea.com
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
wannerandassociates.ca wannerandassociates.ca
brentmacdonald.ca brentmacdonald.ca
wherryandassociates.ca wherryandassociates.ca
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
woodwardandassociates.ca woodwardandassociates.ca
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
costantinigroup.ca costantinigroup.ca
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
danylukandassociates.com danylukandassociates.com
davidhames.ca davidhames.ca
ddkpwm.ca ddkpwm.ca
donfox.us1.advisor.ws donfox.us1.advisor.ws
dupuispwm.com dupuispwm.com
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
equipealainbrunet.com equipealainbrunet.com
equipesimonaube.com equipesimonaube.com
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
equipeyanickjuneau.ca equipeyanickjuneau.ca
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
esserprivatewealth.com esserprivatewealth.com
flanaganandassociates.ca flanaganandassociates.ca
floerfarrowpwm.com floerfarrowpwm.com
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
gerberteam.com gerberteam.com
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
girardandassociates.com girardandassociates.com
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
hoffmangrouppwm.ca hoffmangrouppwm.ca
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
jasonblucke.com jasonblucke.com
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
jeffsmithpwm.ca jeffsmithpwm.ca
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
kenwardgrouppwm.com kenwardgrouppwm.com
kucherawyandassociates.ca kucherawyandassociates.ca
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
lylekarasick.com lylekarasick.com
marcovendramini.com marcovendramini.com
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
pentzwebsterandassociates.com pentzwebsterandassociates.com
philippedumont.com philippedumont.com
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
pompu.ca pompu.ca
foxrevettassociates.com foxrevettassociates.com
reishelpwm.com reishelpwm.com
richardwutzke.com richardwutzke.com
robeby.com robeby.com
robeby.us1.advisor.ws robeby.us1.advisor.ws
runzerandassociates.com runzerandassociates.com
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
santosandassociates.ca santosandassociates.ca
sharmaandassociatespwm.com sharmaandassociatespwm.com
anna-marierasmussen.ca anna-marierasmussen.ca
squireassociates.ca squireassociates.ca
stranskyandassociates.ca stranskyandassociates.ca
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
thlprivatewealth.com thlprivatewealth.com
thomassavage.ca thomassavage.ca
toddandassociatespwm.com toddandassociatespwm.com
bastgroup.ca bastgroup.ca
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
brunotherrien.ca brunotherrien.ca
dalesmallgroup.ca dalesmallgroup.ca
dawsonandassociatespwm.com dawsonandassociatespwm.com
deprezandassociates.com deprezandassociates.com
desfossesgoulet.ca desfossesgoulet.ca
donnellygrouppwm.com donnellygrouppwm.com
elaineandrewandassociates.com elaineandrewandassociates.com
equipejeanthomasmenard.com equipejeanthomasmenard.com
equipelaforme.com equipelaforme.com
equipelptoupin.ca equipelptoupin.ca
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
greghillaby.com greghillaby.com
hallamandassociates.com hallamandassociates.com
hansonprivatewealth.ca hansonprivatewealth.ca
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
kathyduguaypwm.com kathyduguaypwm.com
leboeufpwm.com leboeufpwm.com
macdougallandmaticpwm.com macdougallandmaticpwm.com
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
mcinroypwm.com mcinroypwm.com
methorstandassociates.ca methorstandassociates.ca
mhmrpwm.ca mhmrpwm.ca
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
nolinandassociatespwm.com nolinandassociatespwm.com
angelomanzo.com angelomanzo.com
hagueandassociates.ca hagueandassociates.ca
kapwm.ca kapwm.ca
jesseharris.ca jesseharris.ca
geeandassociates.ca geeandassociates.ca
groupeberardinelli.com groupeberardinelli.com
fr.nathalygagnon.com fr.nathalygagnon.com
larouchepwm.ca larouchepwm.ca
lovisandassociates.com lovisandassociates.com
nathalygagnon.com nathalygagnon.com
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
sajoetassocies.ca sajoetassocies.ca
salsbury.ca salsbury.ca
scepanovicandassociates.com scepanovicandassociates.com
seeleyandshoemaker.com seeleyandshoemaker.com
sharifosterandassociates.ca sharifosterandassociates.ca
simundsonandassociates.ca simundsonandassociates.ca
slaunwhiteandassociates.ca slaunwhiteandassociates.ca
stephenstruthers.us1.advisor.ws stephenstruthers.us1.advisor.ws
stevensandassociates.ca stevensandassociates.ca
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
baileyassociates.ca baileyassociates.ca
beaulieulebuis.com beaulieulebuis.com
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
cameronrennieandassociates.com cameronrennieandassociates.com
claudegallantigprivatewealthcom.us1.advisor.ws claudegallantigprivatewealthcom.us1.advisor.ws
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
davedesrochers.ca davedesrochers.ca
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
fredpentz.us1.advisor.ws fredpentz.us1.advisor.ws
freemangroup.us1.advisor.ws freemangroup.us1.advisor.ws
gagrawal.us1.advisor.ws gagrawal.us1.advisor.ws
garofalodonato.ca garofalodonato.ca
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
hopeandassociates.ca hopeandassociates.ca
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
jonathandaviespwm.ca jonathandaviespwm.ca
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
kennedyassociateswm.us1.advisor.ws kennedyassociateswm.us1.advisor.ws
krallwilliamsgroup.ca krallwilliamsgroup.ca
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
anjalijensen.com anjalijensen.com
markewert.com markewert.com
equipesoniagosselin.ca equipesoniagosselin.ca
bowtellandassociate.ca bowtellandassociate.ca
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
canningandpoolegroup.ca canningandpoolegroup.ca
chevaliermccorristonandassociates.ca chevaliermccorristonandassociates.ca
cheungprivatewealth.ca cheungprivatewealth.ca
chsmwealth.ca chsmwealth.ca
igfr.us1.advisor.ws igfr.us1.advisor.ws
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
kcmprivatewealth.ca kcmprivatewealth.ca
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
leavittgroup.ca leavittgroup.ca
lerouxpepin.ca lerouxpepin.ca
markewert.us1.advisor.ws markewert.us1.advisor.ws
millarddawes.com millarddawes.com
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
nolintoogood.ca nolintoogood.ca
nturner.us1.advisor.ws nturner.us1.advisor.ws
paughcarlsonwealth.ca paughcarlsonwealth.ca
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
potvinlemayetassocies.ca potvinlemayetassocies.ca
samuelswealth.ca samuelswealth.ca
seeleygroup.ca seeleygroup.ca
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
stephenjudd.us1.advisor.ws stephenjudd.us1.advisor.ws
taylorzapotoczny.us1.advisor.ws taylorzapotoczny.us1.advisor.ws
beginbattinggroup.ca beginbattinggroup.ca
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
vinerandselig.ca vinerandselig.ca
walshmckenziedegroot.com walshmckenziedegroot.com
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
fr.gallantgrouppwm.com fr.gallantgrouppwm.com
clairehallam.us1.advisor.ws clairehallam.us1.advisor.ws
claudegallantandassociates.com claudegallantandassociates.com
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
desrochersassociates.us1.advisor.ws desrochersassociates.us1.advisor.ws
equipelangevin.ca equipelangevin.ca
equipeyl.ca equipeyl.ca
gibbingsandassociates.com gibbingsandassociates.com
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
mcgrathandassociateswm.com mcgrathandassociateswm.com
equipetgt.ca equipetgt.ca
greengrouppwm.com greengrouppwm.com
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
huebertandassociates.com huebertandassociates.com
clayfung.ca clayfung.ca
anholtgroup.ca anholtgroup.ca
michelleboeuf.us1.advisor.ws michelleboeuf.us1.advisor.ws
fayeafshar.com fayeafshar.com
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
rawlukprivatewealth.com rawlukprivatewealth.com
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
rspence.us1.advisor.ws rspence.us1.advisor.ws
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
scottsyrja.com scottsyrja.com
alonsoyuffeandassociates.ca alonsoyuffeandassociates.ca
spencelockiegroup.ca spencelockiegroup.ca
taylorzapotoczny.com taylorzapotoczny.com
themorristeam.ca themorristeam.ca
wiartpearsonakle.com wiartpearsonakle.com
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
dhames.us1.advisor.ws dhames.us1.advisor.ws
duanerunzer.us1.advisor.ws duanerunzer.us1.advisor.ws
equipeannegrypinich.ca equipeannegrypinich.ca
equipegilbertpereira.com equipegilbertpereira.com
gobelandassociates.com gobelandassociates.com
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
hopebirkettdawson.ca hopebirkettdawson.ca
kboudreauandassociates.ca kboudreauandassociates.ca
johncornwallandassociates.com johncornwallandassociates.com
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
karlchoquettegestionprivee.ca karlchoquettegestionprivee.ca
kjonesandassociates.ca kjonesandassociates.ca
lacassedelarierafr.us1.advisor.ws lacassedelarierafr.us1.advisor.ws
larmandgroup.com larmandgroup.com
mabeeandassociatespwm.com mabeeandassociatespwm.com
mastroianniassociatespwm.us1.advisor.ws mastroianniassociatespwm.us1.advisor.ws
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
millardwealth.com millardwealth.com
naultgrouppwm.ca naultgrouppwm.ca
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
osmondfindlay.us1.advisor.ws osmondfindlay.us1.advisor.ws
bayandassociates.ca bayandassociates.ca
berardinelligroup.com berardinelligroup.com
amandagraham-rowe.com amandagraham-rowe.com
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
mignaultbadder.ca mignaultbadder.ca
bouwmeestergroup.ca bouwmeestergroup.ca
syrja.ca syrja.ca
dumitruflanaganandassociates.com dumitruflanaganandassociates.com
gallantgrouppwm.com gallantgrouppwm.com
markwebster.ca markwebster.ca
lacassedelariera.com lacassedelariera.com
karenandkayla.ca karenandkayla.ca
dennishuntandassociates.ca dennishuntandassociates.ca
dewashrafandassociates.ca dewashrafandassociates.ca
fr.paulvaillancourt.com fr.paulvaillancourt.com
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
robdaumler.com robdaumler.com
saccoandassociates.ca saccoandassociates.ca
sandraramosandassociates.ca sandraramosandassociates.ca
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
sidarosetassocies.ca sidarosetassocies.ca
sifnakisgroup.com sifnakisgroup.com
slaunwhiteassociates.us1.advisor.ws slaunwhiteassociates.us1.advisor.ws
anholtgrouppwm.us1.advisor.ws anholtgrouppwm.us1.advisor.ws
backup002.us1.advisor.ws backup002.us1.advisor.ws
vanderschuitlamb.ca vanderschuitlamb.ca
wanandassociates.com wanandassociates.com
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
wheelermcivor.ca wheelermcivor.ca
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
csmprivatewealth.ca csmprivatewealth.ca
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
elevateyourwealth.ca elevateyourwealth.ca
engeviksaleskigroup.com engeviksaleskigroup.com
equipebenoitlauzon.ca equipebenoitlauzon.ca
equipefrancismarleau.ca equipefrancismarleau.ca
evanriddell.com evanriddell.com
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
gaylortachauer.ca gaylortachauer.ca
halsimonson.ca halsimonson.ca
jasonblucke.us1.advisor.ws jasonblucke.us1.advisor.ws
kennedyassociates.ca kennedyassociates.ca
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
lalliandassociates.com lalliandassociates.com
nasonandrose.ca nasonandrose.ca
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
osmondfindlay.ca osmondfindlay.ca
paulvaillancourt.com paulvaillancourt.com
rapwm.com rapwm.com
hendriksprivatewealth.ca hendriksprivatewealth.ca
mcclureandcassar.ca mcclureandcassar.ca
daviesmahnke.com daviesmahnke.com
equipestephanethibeault.ca equipestephanethibeault.ca
budhuandassociates.ca budhuandassociates.ca
giannonejoncasetassocies.ca giannonejoncasetassocies.ca
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
groupemanzo.com groupemanzo.com
lyleandassociatespwm.ca lyleandassociatespwm.ca
dionetassocies.ca dionetassocies.ca
DALLAIREANDASSOCIATES.CA
IP History

Click the IP addresses to see over domains using them.