Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

KDSULLIVANWEALTHSTRATEGIES.COM

KDSULLIVANWEALTHSTRATEGIES.COM
Shared Attributes
Domain
kudrowichpwm.com kudrowichpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mertenswealth.com mertenswealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
nathalygagnon.com nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
paziukandassociates.com paziukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
rickdellpwm.com rickdellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
scepanovicandassociates.com scepanovicandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
seeleyandshoemaker.com seeleyandshoemaker.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
simundsonandassociates.ca simundsonandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 157 days
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
sylvielefebvre.com sylvielefebvre.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
thekilgourgroup.com thekilgourgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
tobacpwm.com tobacpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
bcbgestionprivee.com bcbgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 80 days
trudybuttandassociates.com trudybuttandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
benkeandassociates.com benkeandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
vignoneassociatespwm.com vignoneassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
wolkerandassociatespwm.com wolkerandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
cameronrennieandassociates.com cameronrennieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 77 days
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
zarnlochheadpwm.com zarnlochheadpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 146 days
claudegallant.com claudegallant.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 74 days
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
courcellesgroup.com courcellesgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
davedesrochers.ca davedesrochers.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 130 days
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipedaoust.ca equipedaoust.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipemicheldesbiens.com equipemicheldesbiens.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
finchgoodale.com finchgoodale.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 125 days
floermillikengroup.com floermillikengroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
garofaloandassociates.ca garofaloandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jeffsomerspwm.com jeffsomerspwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Aug 2023 117 days
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 117 days
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
markewert.com markewert.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 173 days
agrawalassociates.ca agrawalassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
bourgeaultandassociates.com bourgeaultandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
metzgergroup.ca metzgergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 54 days
mehrotragroup.com mehrotragroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
loretoryder.com loretoryder.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
buhrblaylock.com buhrblaylock.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mielefinancialgroup.ca mielefinancialgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
chmprivatewealth.ca chmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
freemangroup.ca freemangroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
farrowandassociatespwm.com farrowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kalinkaprivatewealth.com kalinkaprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 117 days
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
karasickprivatewealth.com karasickprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jun 2023 61 days
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kcmprivatewealth.ca kcmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 59 days
kevinkaiser.ca kevinkaiser.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
leavittgroup.ca leavittgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
lehouxgestionprivee.com lehouxgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
lisabell.ca lisabell.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Apr 2023 3 days
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Apr 2023 3 days
loboandassociatespwm.ca loboandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
macmahonandassociates.com macmahonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jun 2023 65 days
markewert.us1.advisor.ws markewert.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mignaultprivatewealth.com mignaultprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
millarddawes.com millarddawes.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mondouetassocies.com mondouetassocies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
nolintoogood.ca nolintoogood.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 51 days
nturner.us1.advisor.ws nturner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
peterdefrancesco.com peterdefrancesco.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
powellpwm.com powellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
princeandassociates.ca princeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
ryangroupwealth.com ryangroupwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
schillerspence.ca schillerspence.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 82 days
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
snowandassociatespwm.com snowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
spenceandassociatespwm.com spenceandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
stevenboydpwm.com stevenboydpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
vickendurgerian.com vickendurgerian.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 149 days
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 33 days
walshmckenziedegroot.com walshmckenziedegroot.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 32 days
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
brodieandassociates.com brodieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
carneylyster.com carneylyster.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
claudegallantandassociates.com claudegallantandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
colbournegroup.com colbournegroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
coleentaylor.ca coleentaylor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
donfox.net donfox.net
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
elliottchaulk.com elliottchaulk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipetremblay.com equipetremblay.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
gibbingsandassociates.com gibbingsandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
ginettebradette.ca ginettebradette.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jasondaleo.ca jasondaleo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jennerandassociates.com jennerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
gabechiodo.ca gabechiodo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 133 days
greengrouppwm.com greengrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
harveypwm.ca harveypwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
johnmazziotti.com johnmazziotti.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
carterprivatewealth.com carterprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
milngroup.com milngroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
charbonneauetassocies.ca charbonneauetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jenningsgroup.ca jenningsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
dehartandassociates.com dehartandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
landriaultpwm.com landriaultpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 176 days
edbootle.ca edbootle.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
fayeafshar.com fayeafshar.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
irenevassalo.com irenevassalo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
juddbissonandassociates.com juddbissonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
rawlukprivatewealth.com rawlukprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
roesthovesquire.ca roesthovesquire.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 156 days
rspence.us1.advisor.ws rspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
scottsyrja.com scottsyrja.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
sylvainmorin.ca sylvainmorin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 May 2023 24 days
taylorzapotoczny.com taylorzapotoczny.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
themorristeam.ca themorristeam.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
thiessenpwm.com thiessenpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
tmassociates.ca tmassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
wannerandassociates.ca wannerandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
wherryandassociates.ca wherryandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
woodwardandassociates.ca woodwardandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
costantinigroup.ca costantinigroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
davidhames.ca davidhames.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
ddkpwm.ca ddkpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
dhames.us1.advisor.ws dhames.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
donfox.us1.advisor.ws donfox.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipegilbertpereira.com equipegilbertpereira.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipemarcantoinereid.com equipemarcantoinereid.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipesimonaube.com equipesimonaube.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipeyanickjuneau.ca equipeyanickjuneau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
esserprivatewealth.com esserprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
flanaganandassociates.ca flanaganandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
floerfarrowpwm.com floerfarrowpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Sep 2023 169 days
foxrevettassociates.com foxrevettassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
gerberteam.com gerberteam.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
girardandassociates.com girardandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jeffsmithpwm.ca jeffsmithpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
johncornwallandassociates.com johncornwallandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kenwardgrouppwm.com kenwardgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kucherawyandassociates.ca kucherawyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
larmandgroup.com larmandgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mabeeandassociatespwm.com mabeeandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 173 days
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 54 days
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
naultgrouppwm.ca naultgrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
pentzwebsterandassociates.com pentzwebsterandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 165 days
philippedumont.com philippedumont.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 164 days
pompu.ca pompu.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
bayandassociates.ca bayandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
blackbelyea.com blackbelyea.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
godwinandassociates.ca godwinandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
syrja.ca syrja.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
brentmacdonald.ca brentmacdonald.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
hoffmangrouppwm.ca hoffmangrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
dupuispwm.com dupuispwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipealainbrunet.com equipealainbrunet.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
dallaireandassociates.ca dallaireandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
lacassedelariera.com lacassedelariera.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
danylukandassociates.com danylukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
karenandkayla.ca karenandkayla.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jasonblucke.com jasonblucke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
dennishuntandassociates.ca dennishuntandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
gobelandassociates.com gobelandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
reishelpwm.com reishelpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
richardwutzke.com richardwutzke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
robdaumler.com robdaumler.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
robeby.com robeby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
runzerandassociates.com runzerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 101 days
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
santosandassociates.ca santosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 159 days
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
sharmaandassociatespwm.com sharmaandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
sifnakisgroup.com sifnakisgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 99 days
anna-marierasmussen.ca anna-marierasmussen.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Sep 2023 154 days
stranskyandassociates.ca stranskyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
thlprivatewealth.com thlprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
thomassavage.ca thomassavage.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
toddandassociatespwm.com toddandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 90 days
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
wheelermcivor.ca wheelermcivor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 32 days
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 77 days
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2023 One Off
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2023 Oct 2023 14 days
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
elevateyourwealth.ca elevateyourwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 127 days
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
gaylortachauer.ca gaylortachauer.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
greghillaby.com greghillaby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 122 days
hallamandassociates.com hallamandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
hansonprivatewealth.ca hansonprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kathyduguaypwm.com kathyduguaypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
lalliandassociates.com lalliandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
leboeufpwm.com leboeufpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
macdougallandmaticpwm.com macdougallandmaticpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
marianasemenchuk.com marianasemenchuk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
nolinandassociatespwm.com nolinandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jun 2023 70 days
paulvaillancourt.com paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
rapwm.com rapwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
methorstandassociates.ca methorstandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kapwm.ca kapwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
robeby.us1.advisor.ws robeby.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
daviesmahnke.com daviesmahnke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipelaforme.com equipelaforme.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
jwrossandassociates.ca jwrossandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
brunotherrien.ca brunotherrien.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
elaineandrewandassociates.com elaineandrewandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
donnellygrouppwm.com donnellygrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
dalesmallgroup.ca dalesmallgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
loweandassociates.ca loweandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mcinroypwm.com mcinroypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 172 days
geeandassociates.ca geeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
dawsonandassociatespwm.com dawsonandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipejeanthomasmenard.com equipejeanthomasmenard.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mhmrpwm.ca mhmrpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
equipelptoupin.ca equipelptoupin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
bastgroup.ca bastgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
deprezandassociates.com deprezandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
desfossesgoulet.ca desfossesgoulet.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
KDSULLIVANWEALTHSTRATEGIES.COM
Non IP Attributes
Attribute First Last
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023
KDSULLIVANWEALTHSTRATEGIES.COM
Overlap Attribute Domains
kudrowichpwm.com kudrowichpwm.com
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
mertenswealth.com mertenswealth.com
nathalygagnon.com nathalygagnon.com
paziukandassociates.com paziukandassociates.com
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
rickdellpwm.com rickdellpwm.com
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
scepanovicandassociates.com scepanovicandassociates.com
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
seeleyandshoemaker.com seeleyandshoemaker.com
simundsonandassociates.ca simundsonandassociates.ca
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
sylvielefebvre.com sylvielefebvre.com
thekilgourgroup.com thekilgourgroup.com
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
tobacpwm.com tobacpwm.com
bcbgestionprivee.com bcbgestionprivee.com
trudybuttandassociates.com trudybuttandassociates.com
benkeandassociates.com benkeandassociates.com
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
vignoneassociatespwm.com vignoneassociatespwm.com
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
wolkerandassociatespwm.com wolkerandassociatespwm.com
cameronrennieandassociates.com cameronrennieandassociates.com
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
zarnlochheadpwm.com zarnlochheadpwm.com
claudegallant.com claudegallant.com
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
courcellesgroup.com courcellesgroup.com
davedesrochers.ca davedesrochers.ca
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
equipedaoust.ca equipedaoust.ca
equipemicheldesbiens.com equipemicheldesbiens.com
finchgoodale.com finchgoodale.com
floermillikengroup.com floermillikengroup.com
garofaloandassociates.ca garofaloandassociates.ca
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
jeffsomerspwm.com jeffsomerspwm.com
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
markewert.com markewert.com
agrawalassociates.ca agrawalassociates.ca
bourgeaultandassociates.com bourgeaultandassociates.com
metzgergroup.ca metzgergroup.ca
mehrotragroup.com mehrotragroup.com
loretoryder.com loretoryder.com
buhrblaylock.com buhrblaylock.com
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
mielefinancialgroup.ca mielefinancialgroup.ca
chmprivatewealth.ca chmprivatewealth.ca
freemangroup.ca freemangroup.ca
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
farrowandassociatespwm.com farrowandassociatespwm.com
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
kalinkaprivatewealth.com kalinkaprivatewealth.com
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
karasickprivatewealth.com karasickprivatewealth.com
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
kcmprivatewealth.ca kcmprivatewealth.ca
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
kevinkaiser.ca kevinkaiser.ca
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
leavittgroup.ca leavittgroup.ca
lehouxgestionprivee.com lehouxgestionprivee.com
lisabell.ca lisabell.ca
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
loboandassociatespwm.ca loboandassociatespwm.ca
macmahonandassociates.com macmahonandassociates.com
markewert.us1.advisor.ws markewert.us1.advisor.ws
mignaultprivatewealth.com mignaultprivatewealth.com
millarddawes.com millarddawes.com
mondouetassocies.com mondouetassocies.com
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
nolintoogood.ca nolintoogood.ca
nturner.us1.advisor.ws nturner.us1.advisor.ws
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
peterdefrancesco.com peterdefrancesco.com
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
powellpwm.com powellpwm.com
princeandassociates.ca princeandassociates.ca
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
ryangroupwealth.com ryangroupwealth.com
schillerspence.ca schillerspence.ca
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
snowandassociatespwm.com snowandassociatespwm.com
spenceandassociatespwm.com spenceandassociatespwm.com
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
stevenboydpwm.com stevenboydpwm.com
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
vickendurgerian.com vickendurgerian.com
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
walshmckenziedegroot.com walshmckenziedegroot.com
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
brodieandassociates.com brodieandassociates.com
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
carneylyster.com carneylyster.com
claudegallantandassociates.com claudegallantandassociates.com
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
colbournegroup.com colbournegroup.com
coleentaylor.ca coleentaylor.ca
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
donfox.net donfox.net
elliottchaulk.com elliottchaulk.com
equipetremblay.com equipetremblay.com
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
gibbingsandassociates.com gibbingsandassociates.com
ginettebradette.ca ginettebradette.ca
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
jasondaleo.ca jasondaleo.ca
jennerandassociates.com jennerandassociates.com
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
gabechiodo.ca gabechiodo.ca
greengrouppwm.com greengrouppwm.com
harveypwm.ca harveypwm.ca
johnmazziotti.com johnmazziotti.com
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
carterprivatewealth.com carterprivatewealth.com
milngroup.com milngroup.com
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
charbonneauetassocies.ca charbonneauetassocies.ca
jenningsgroup.ca jenningsgroup.ca
dehartandassociates.com dehartandassociates.com
landriaultpwm.com landriaultpwm.com
edbootle.ca edbootle.ca
fayeafshar.com fayeafshar.com
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
irenevassalo.com irenevassalo.com
juddbissonandassociates.com juddbissonandassociates.com
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
rawlukprivatewealth.com rawlukprivatewealth.com
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
roesthovesquire.ca roesthovesquire.ca
rspence.us1.advisor.ws rspence.us1.advisor.ws
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
scottsyrja.com scottsyrja.com
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
sylvainmorin.ca sylvainmorin.ca
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
taylorzapotoczny.com taylorzapotoczny.com
themorristeam.ca themorristeam.ca
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
thiessenpwm.com thiessenpwm.com
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
tmassociates.ca tmassociates.ca
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
wannerandassociates.ca wannerandassociates.ca
wherryandassociates.ca wherryandassociates.ca
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
woodwardandassociates.ca woodwardandassociates.ca
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
costantinigroup.ca costantinigroup.ca
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
davidhames.ca davidhames.ca
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
ddkpwm.ca ddkpwm.ca
dhames.us1.advisor.ws dhames.us1.advisor.ws
donfox.us1.advisor.ws donfox.us1.advisor.ws
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
equipegilbertpereira.com equipegilbertpereira.com
equipemarcantoinereid.com equipemarcantoinereid.com
equipesimonaube.com equipesimonaube.com
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
equipeyanickjuneau.ca equipeyanickjuneau.ca
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
esserprivatewealth.com esserprivatewealth.com
flanaganandassociates.ca flanaganandassociates.ca
floerfarrowpwm.com floerfarrowpwm.com
foxrevettassociates.com foxrevettassociates.com
gerberteam.com gerberteam.com
girardandassociates.com girardandassociates.com
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
jeffsmithpwm.ca jeffsmithpwm.ca
johncornwallandassociates.com johncornwallandassociates.com
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
kenwardgrouppwm.com kenwardgrouppwm.com
kucherawyandassociates.ca kucherawyandassociates.ca
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
larmandgroup.com larmandgroup.com
mabeeandassociatespwm.com mabeeandassociatespwm.com
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
naultgrouppwm.ca naultgrouppwm.ca
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
pentzwebsterandassociates.com pentzwebsterandassociates.com
philippedumont.com philippedumont.com
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
pompu.ca pompu.ca
bayandassociates.ca bayandassociates.ca
blackbelyea.com blackbelyea.com
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
godwinandassociates.ca godwinandassociates.ca
syrja.ca syrja.ca
brentmacdonald.ca brentmacdonald.ca
hoffmangrouppwm.ca hoffmangrouppwm.ca
dupuispwm.com dupuispwm.com
equipealainbrunet.com equipealainbrunet.com
dallaireandassociates.ca dallaireandassociates.ca
lacassedelariera.com lacassedelariera.com
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
danylukandassociates.com danylukandassociates.com
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
karenandkayla.ca karenandkayla.ca
jasonblucke.com jasonblucke.com
dennishuntandassociates.ca dennishuntandassociates.ca
gobelandassociates.com gobelandassociates.com
reishelpwm.com reishelpwm.com
richardwutzke.com richardwutzke.com
robdaumler.com robdaumler.com
robeby.com robeby.com
runzerandassociates.com runzerandassociates.com
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
santosandassociates.ca santosandassociates.ca
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
sharmaandassociatespwm.com sharmaandassociatespwm.com
sifnakisgroup.com sifnakisgroup.com
anna-marierasmussen.ca anna-marierasmussen.ca
stranskyandassociates.ca stranskyandassociates.ca
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
thlprivatewealth.com thlprivatewealth.com
thomassavage.ca thomassavage.ca
toddandassociatespwm.com toddandassociatespwm.com
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
wheelermcivor.ca wheelermcivor.ca
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
elevateyourwealth.ca elevateyourwealth.ca
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
gaylortachauer.ca gaylortachauer.ca
greghillaby.com greghillaby.com
hallamandassociates.com hallamandassociates.com
hansonprivatewealth.ca hansonprivatewealth.ca
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
kathyduguaypwm.com kathyduguaypwm.com
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
lalliandassociates.com lalliandassociates.com
leboeufpwm.com leboeufpwm.com
macdougallandmaticpwm.com macdougallandmaticpwm.com
marianasemenchuk.com marianasemenchuk.com
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
nolinandassociatespwm.com nolinandassociatespwm.com
paulvaillancourt.com paulvaillancourt.com
rapwm.com rapwm.com
methorstandassociates.ca methorstandassociates.ca
kapwm.ca kapwm.ca
robeby.us1.advisor.ws robeby.us1.advisor.ws
daviesmahnke.com daviesmahnke.com
equipelaforme.com equipelaforme.com
jwrossandassociates.ca jwrossandassociates.ca
brunotherrien.ca brunotherrien.ca
elaineandrewandassociates.com elaineandrewandassociates.com
donnellygrouppwm.com donnellygrouppwm.com
dalesmallgroup.ca dalesmallgroup.ca
loweandassociates.ca loweandassociates.ca
mcinroypwm.com mcinroypwm.com
geeandassociates.ca geeandassociates.ca
dawsonandassociatespwm.com dawsonandassociatespwm.com
equipejeanthomasmenard.com equipejeanthomasmenard.com
mhmrpwm.ca mhmrpwm.ca
equipelptoupin.ca equipelptoupin.ca
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
bastgroup.ca bastgroup.ca
deprezandassociates.com deprezandassociates.com
desfossesgoulet.ca desfossesgoulet.ca
KDSULLIVANWEALTHSTRATEGIES.COM
IP History

Click the IP addresses to see over domains using them.