Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

TRANTERANDASSOCIATESPRIVATEWEALTHMANAGEMENT.COM

TRANTERANDASSOCIATESPRIVATEWEALTHMANAGEMENT.COM
Shared Attributes
Domain
irenevassalo.com irenevassalo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Jan 2019 2 years, 222 days
UA UA-72991320 Jun 2016 Jan 2019 2 years, 222 days
UA UA-67387079 Jun 2016 Jan 2019 2 years, 222 days
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 185 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 184 days
reishelpwm.com reishelpwm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Jan 2019 2 years, 219 days
UA UA-72991320 Jun 2016 Jan 2019 2 years, 219 days
UA UA-67387079 Jun 2016 Jan 2019 2 years, 219 days
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 148 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 166 days
kudrowichpwm.com kudrowichpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 167 days
UA UA-2868753 Jan 2018 Nov 2018 316 days
UA UA-67387079 Jan 2018 Nov 2018 316 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 182 days
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 166 days
UA UA-2868753 Jun 2016 Sep 2017 1 year, 89 days
UA UA-67387079 Jun 2016 Sep 2017 1 year, 89 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 182 days
vignoneassociatespwm.com vignoneassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 131 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
garofaloandassociates.ca garofaloandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 192 days
UA UA-2868753 Oct 2016 Sep 2017 320 days
UA UA-67387079 Oct 2016 Sep 2017 320 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
kevinkaiser.ca kevinkaiser.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Jan 2019 2 years, 223 days
UA UA-67387079 Jun 2016 Jan 2019 2 years, 223 days
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 167 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
landriaultpwm.com landriaultpwm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Dec 2016 Oct 2017 282 days
UA UA-67387079 Dec 2016 Oct 2017 282 days
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 202 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 55 days
mignaultprivatewealth.com mignaultprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 161 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
peterdefrancesco.com peterdefrancesco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Jan 2019 2 years, 212 days
UA UA-67387079 Jun 2016 Jan 2019 2 years, 212 days
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 152 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 175 days
powellpwm.com powellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 151 days
UA UA-2868753 Feb 2017 Oct 2017 235 days
UA UA-67387079 Feb 2017 Oct 2017 235 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 175 days
dehartandassociates.com dehartandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Feb 2017 Jan 2019 1 year, 345 days
UA UA-67387079 Feb 2017 Jan 2019 1 year, 345 days
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 200 days
edbootle.ca edbootle.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 198 days
UA UA-2868753 Oct 2016 Jul 2017 276 days
UA UA-67387079 Oct 2016 Jul 2017 276 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 190 days
johnmazziotti.com johnmazziotti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-67387079 Jun 2016 Jan 2019 2 years, 220 days
UA UA-2868753 Jun 2016 Jan 2019 2 years, 220 days
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 184 days
flanaganandassociates.ca flanaganandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 194 days
UA UA-2868753 Aug 2016 Oct 2017 1 year, 37 days
UA UA-67387079 Aug 2016 Oct 2017 1 year, 37 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 205 days
girardandassociates.com girardandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Jul 2019 3 years, 33 days
UA UA-67387079 Jun 2016 Jul 2019 3 years, 33 days
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 45 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 164 days
richardwutzke.com richardwutzke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 147 days
UA UA-2868753 Nov 2016 Oct 2017 317 days
UA UA-67387079 Nov 2016 Oct 2017 317 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 173 days
robeby.com robeby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Jul 2019 3 years, 33 days
UA UA-67387079 Jun 2016 Jul 2019 3 years, 33 days
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 147 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
toddandassociatespwm.com toddandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Sep 2017 Jul 2019 1 year, 309 days
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
UA UA-67387079 Sep 2017 Jan 2019 1 year, 116 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
elaineandrewandassociates.com elaineandrewandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 197 days
UA UA-2868753 Dec 2016 Oct 2017 282 days
UA UA-67387079 Dec 2016 Oct 2017 282 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 190 days
leboeufpwm.com leboeufpwm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Jan 2019 2 years, 210 days
UA UA-67387079 Jun 2016 Jan 2019 2 years, 210 days
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 31 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 182 days
loweandassociates.ca loweandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Jan 2019 2 years, 221 days
UA UA-67387079 Jun 2016 Jan 2019 2 years, 221 days
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 165 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 145 days
macdougallandmaticpwm.com macdougallandmaticpwm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Sep 2017 Jul 2019 1 year, 309 days
UA UA-67387079 Sep 2017 Jul 2019 1 year, 309 days
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 294 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 180 days
nolinandassociatespwm.com nolinandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2023 1 year, 23 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 139 days
markewert.com markewert.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 115 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 115 days
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 199 days
scepanovicandassociates.com scepanovicandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Oct 2016 Jun 2019 2 years, 221 days
UA UA-67387079 Oct 2016 Jun 2019 2 years, 221 days
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 145 days
shirleyhill.net shirleyhill.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
UA UA-72991320 Jun 2016 Oct 2017 1 year, 114 days
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 214 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
leavittgroup.ca leavittgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Oct 2016 Jan 2019 2 years, 74 days
UA UA-67387079 Oct 2016 Jan 2019 2 years, 74 days
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 166 days
michelberniergpp.com michelberniergpp.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Feb 2017 Jul 2019 2 years, 157 days
UA UA-67387079 Feb 2017 Oct 2017 238 days
UA UA-72991320 Feb 2017 Oct 2017 238 days
pwmwebbuilder.com pwmwebbuilder.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2016 134 days
UA UA-67387079 Jun 2016 Oct 2016 134 days
UA UA-72991320 Jun 2016 Oct 2016 134 days
dirobinsonandassociates.com dirobinsonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
UA UA-72991320 Jun 2016 Oct 2017 1 year, 114 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
fayeafshar.com fayeafshar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jul 2016 Jan 2019 2 years, 166 days
UA UA-67387079 Jul 2016 Jan 2019 2 years, 166 days
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 195 days
gibbingsandassociates.com gibbingsandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Nov 2016 Jan 2019 2 years, 58 days
UA UA-67387079 Nov 2016 Jan 2019 2 years, 58 days
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 191 days
brianwalkerprivatewealth.com brianwalkerprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Feb 2017 Oct 2017 238 days
UA UA-67387079 Feb 2017 Oct 2017 238 days
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Apr 2022 One Off
equipemarcantoinereid.com equipemarcantoinereid.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 196 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 190 days
UA UA-2868753 Feb 2019 Jul 2019 164 days
equipesimonaube.com equipesimonaube.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 196 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 190 days
UA UA-2868753 Feb 2019 Feb 2019 One Off
joelbraypwm.com joelbraypwm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Sep 2017 1 year, 89 days
UA UA-72991320 Jun 2016 Sep 2017 1 year, 89 days
UA UA-67387079 Jun 2016 Sep 2017 1 year, 89 days
robdaumler.com robdaumler.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 147 days
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
fredkolodrubsky.ca fredkolodrubsky.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Oct 2016 Jul 2019 2 years, 286 days
UA UA-72991320 Oct 2016 Jul 2019 2 years, 286 days
UA UA-67387079 Oct 2016 Jul 2019 2 years, 286 days
geeandassociates.ca geeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 192 days
UA UA-2868753 Jun 2016 Sep 2017 1 year, 89 days
UA UA-67387079 Jun 2016 Sep 2017 1 year, 89 days
paulvaillancourt.com paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Feb 2017 Jan 2019 1 year, 331 days
UA UA-67387079 Feb 2017 Jan 2019 1 year, 331 days
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 153 days
loretoryder.com loretoryder.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 165 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 181 days
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 163 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 143 days
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 163 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
mehrotragroup.com mehrotragroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 292 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
mertenswealth.com mertenswealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 162 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 25 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
mielefinancialgroup.ca mielefinancialgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 161 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
paziukandassociates.com paziukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 16 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 9 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 123 days
rickdellpwm.com rickdellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 147 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 173 days
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 9 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 123 days
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 147 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
rprobinsonpwm.ca rprobinsonpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 145 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 120 days
agrawalassociates.ca agrawalassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 345 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 190 days
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2023 101 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
sylvielefebvre.com sylvielefebvre.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 176 days
thekilgourgroup.com thekilgourgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 140 days
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
tobacpwm.com tobacpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
bcbgestionprivee.com bcbgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 106 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Nov 2022 One Off
trudybuttandassociates.com trudybuttandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 228 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
benkeandassociates.com benkeandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 210 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Nov 2022 One Off
bourgeaultandassociates.com bourgeaultandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 224 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Nov 2022 One Off
brunotherrien.us1.advisor.ws brunotherrien.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Nov 2022 One Off
GTM GTM-G-0FSFL4QW1Q Nov 2022 Nov 2022 One Off
buhrblaylock.com buhrblaylock.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 196 days
wolkerandassociatespwm.com wolkerandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 223 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Nov 2022 One Off
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 352 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 180 days
zarnlochheadpwm.com zarnlochheadpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 172 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 35 days
chiodobirkettandassociates.com chiodobirkettandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2023 340 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Mar 2023 128 days
chmprivatewealth.ca chmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Oct 2023 1 year, 62 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 186 days
claudegallant.com claudegallant.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 204 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 155 days
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 203 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
courcellesgroup.com courcellesgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 203 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 199 days
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipedaoust.ca equipedaoust.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 218 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 66 days
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipemicheldesbiens.com equipemicheldesbiens.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 196 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 188 days
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2022 241 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
farrowandassociatespwm.com farrowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 195 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 188 days
finchgoodale.com finchgoodale.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 151 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2023 343 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Mar 2023 101 days
floermillikengroup.com floermillikengroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 48 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 167 days
freemangroup.ca freemangroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 193 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Dec 2022 40 days
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 191 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 187 days
jeffsomerspwm.com jeffsomerspwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Aug 2023 1 year, 81 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 184 days
jenningsandassociates.ca jenningsandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Apr 2023 327 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 155 days
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2022 229 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Dec 2022 52 days
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 35 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 154 days
juddbissonandassociates.com juddbissonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 183 days
karasickprivatewealth.com karasickprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jun 2023 256 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 34 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 167 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 152 days
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 167 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 152 days
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 167 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 182 days
lehouxgestionprivee.com lehouxgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 166 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 182 days
lisabell.ca lisabell.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Apr 2023 329 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 130 days
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Apr 2023 193 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 95 days
loboandassociatespwm.ca loboandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 296 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 181 days
macmahonandassociates.com macmahonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jun 2023 254 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 180 days
mhmprivatewealth.com mhmprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
milesschiller.com milesschiller.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
milngroup.com milngroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 161 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
mondouetassocies.com mondouetassocies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 23 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 16 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 90 days
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 280 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 130 days
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 100 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 15 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
princeandassociates.ca princeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 277 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 127 days
ramoslaine.com ramoslaine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jul 2016 Oct 2017 1 year, 68 days
UA UA-67387079 Jul 2016 Oct 2017 1 year, 68 days
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 147 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 123 days
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 147 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 123 days
ryangroupwealth.com ryangroupwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 8 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 172 days
schillerspence.ca schillerspence.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 270 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 135 days
agbaileyandassociates.com agbaileyandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Dec 2016 197 days
UA UA-67387079 Jun 2016 Dec 2016 197 days
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 120 days
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 221 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
sergiosalina.com sergiosalina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
snowandassociatespwm.com snowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 142 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 171 days
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Apr 2023 83 days
stevenboydpwm.com stevenboydpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 170 days
strussanddennyprivatewealthmanagement.com strussanddennyprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
teamlacassestephens.com teamlacassestephens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Aug 2017 Oct 2017 58 days
UA UA-67387079 Aug 2017 Oct 2017 58 days
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 81 days
vickendurgerian.com vickendurgerian.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 175 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 25 days
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2023 Oct 2023 252 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 78 days
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 335 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 174 days
brodieandassociates.com brodieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 196 days
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 224 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
carneylyster.com carneylyster.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 207 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 186 days
carterprivatewealth.com carterprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 206 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 196 days
charbonneauetassocies.ca charbonneauetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Oct 2023 1 year, 62 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 195 days
colbournegroup.com colbournegroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 228 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 147 days
coleentaylor.ca coleentaylor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Oct 2023 1 year, 60 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 193 days
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 199 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
donfox.net donfox.net
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 199 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 174 days
elliottchaulk.com elliottchaulk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 197 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 190 days
equipemichelcote.com equipemichelcote.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Sep 2017 1 year, 89 days
UA UA-67387079 Jun 2016 Sep 2017 1 year, 89 days
equipetremblay.com equipetremblay.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 196 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 190 days
gabechiodo.ca gabechiodo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 159 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 22 days
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 214 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
ginettebradette.ca ginettebradette.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 191 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 189 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Mar 2023 100 days
harveypwm.ca harveypwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 42 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 187 days
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 187 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 158 days
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
jasondaleo.ca jasondaleo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 206 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 57 days
jbfgroup.ca jbfgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Feb 2017 Oct 2017 238 days
UA UA-67387079 Feb 2017 Oct 2017 238 days
jennerandassociates.com jennerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 184 days
jenningsgroup.ca jenningsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 184 days
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 35 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 154 days
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 125 days
roesthovesquire.ca roesthovesquire.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 182 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 32 days
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 139 days
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 1 day
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
sylvainmorin.ca sylvainmorin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 169 days
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 176 days
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 May 2023 185 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 176 days
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 81 days
thiessenpwm.com thiessenpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 338 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Mar 2023 102 days
tmassociates.ca tmassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 168 days
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 228 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 80 days
blackbelyea.com blackbelyea.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2022 Oct 2023 1 year, 104 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Mar 2023 101 days
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 226 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
wannerandassociates.ca wannerandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 225 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 205 days
brentmacdonald.ca brentmacdonald.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 186 days
wherryandassociates.ca wherryandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 224 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 204 days
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 232 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 223 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 181 days
woodwardandassociates.ca woodwardandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 223 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 203 days
carneywealthmanagement.com carneywealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Sep 2017 1 year, 89 days
UA UA-67387079 Jun 2016 Sep 2017 1 year, 89 days
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 207 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 183 days
costantinigroup.ca costantinigroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 203 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 193 days
dallaireandassociates.ca dallaireandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 202 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 327 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
danylukandassociates.com danylukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Oct 2023 1 year, 58 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 192 days
ddkpwm.ca ddkpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 57 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 192 days
demersandassociates.ca demersandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Sep 2017 1 year, 89 days
UA UA-67387079 Jun 2016 Sep 2017 1 year, 89 days
donfox.us1.advisor.ws donfox.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 199 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
dupuispwm.com dupuispwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 323 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 186 days
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 197 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Dec 2022 35 days
equipealainbrunet.com equipealainbrunet.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 196 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 170 days
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 196 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipeyanickjuneau.ca equipeyanickjuneau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 196 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 170 days
floerfarrowpwm.com floerfarrowpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2023 1 year, 158 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Dec 2022 39 days
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Dec 2022 39 days
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2022 242 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 46 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Dec 2022 41 days
gerberteam.com gerberteam.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 192 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 188 days
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
godwinandassociates.ca godwinandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 191 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 188 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
hoffmangrouppwm.ca hoffmangrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 188 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 186 days
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 155 days
jasonblucke.com jasonblucke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 36 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 184 days
jeffsmithpwm.ca jeffsmithpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 36 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2022 229 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 167 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Dec 2022 53 days
kenwardgrouppwm.com kenwardgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 204 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 183 days
kucherawyandassociates.ca kucherawyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 167 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Apr 2023 One Off
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 166 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 150 days
lylekarasick.com lylekarasick.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2023 99 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Jan 2023 63 days
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 28 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 94 days
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 99 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 26 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 143 days
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 199 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 49 days
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 163 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 24 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 157 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 135 days
normanpiche.ca normanpiche.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-67387079 Jun 2016 Jul 2016 46 days
UA UA-2868753 Jun 2016 Jul 2016 46 days
oxleymetzgerpwm.com oxleymetzgerpwm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Feb 2017 Oct 2017 238 days
UA UA-67387079 Feb 2017 Oct 2017 238 days
pentzwebsterandassociates.com pentzwebsterandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 191 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 138 days
philippedumont.com philippedumont.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 152 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 175 days
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 152 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 130 days
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 190 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 40 days
pompu.ca pompu.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 151 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
robeby.us1.advisor.ws robeby.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 147 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 123 days
runzerandassociates.com runzerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 127 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 44 days
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 8 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 122 days
santosandassociates.ca santosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 185 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 35 days
sharmaandassociatespwm.com sharmaandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 171 days
anna-marierasmussen.ca anna-marierasmussen.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Sep 2023 1 year, 164 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 184 days
squireassociates.ca squireassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 128 days
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2023 102 days
stranskyandassociates.ca stranskyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 170 days
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 1 day
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 139 days
thlprivatewealth.com thlprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 361 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 140 days
bastgroup.ca bastgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 338 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 188 days
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Feb 2023 102 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Feb 2023 101 days
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 174 days
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 233 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 72 days
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2022 Oct 2023 1 year, 104 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 Mar 2023 103 days
brunotherrien.ca brunotherrien.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 208 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 196 days
dalesmallgroup.ca dalesmallgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 327 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 186 days
deprezandassociates.com deprezandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 326 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 176 days
desfossesgoulet.ca desfossesgoulet.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 57 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 191 days
equipedbergeron.com equipedbergeron.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-67387079 Jun 2016 Sep 2017 1 year, 89 days
UA UA-2868753 Jun 2016 Sep 2017 1 year, 89 days
equipejeanthomasmenard.com equipejeanthomasmenard.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 51 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 190 days
equipelaforme.com equipelaforme.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 196 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 190 days
equipelptoupin.ca equipelptoupin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 51 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
gillickandassociatespwm.com gillickandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Aug 2016 Oct 2017 1 year, 37 days
UA UA-67387079 Aug 2016 Oct 2017 1 year, 37 days
greghillaby.com greghillaby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 148 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 May 2023 60 days
hallamandassociates.com hallamandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 311 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 187 days
hansonprivatewealth.ca hansonprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 189 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 187 days
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 36 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 155 days
jonwhiteheadandassociates.com jonwhiteheadandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 153 days
jwrossandassociates.ca jwrossandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 35 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 183 days
kathyduguaypwm.com kathyduguaypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 204 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 104 days
kenhendriks.com kenhendriks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
UA UA-67387079 Jun 2016 Oct 2017 1 year, 114 days
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 164 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
marianasemenchuk.com marianasemenchuk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 163 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
marioloreto.com marioloreto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jul 2016 Oct 2017 1 year, 68 days
UA UA-67387079 Jul 2016 Oct 2017 1 year, 68 days
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 163 days
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 163 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 143 days
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 162 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 142 days
mcinroypwm.com mcinroypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 198 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 101 days
methorstandassociates.ca methorstandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 162 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 May 2023 142 days
mhmrpwm.ca mhmrpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 161 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 99 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
oconnorandassociates.ca oconnorandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Sep 2017 1 year, 89 days
UA UA-67387079 Jun 2016 Sep 2017 1 year, 89 days
lovisandassociates.com lovisandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Sep 2022 137 days
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 26 days
nathalygagnon.com nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 158 days
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2023 17 days
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 9 days
russjennings.ca russjennings.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Aug 2016 Aug 2016 One Off
seeleyandshoemaker.com seeleyandshoemaker.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
simundsonandassociates.ca simundsonandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 183 days
solutionsbanking.ca solutionsbanking.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Apr 2017 299 days
stevensandassociates.ca stevensandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2023 5 days
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 228 days
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 208 days
cameronrennieandassociates.com cameronrennieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 103 days
nathalygagnon.com fr.nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jan 2023 38 days
claudegallantigprivatewealthcom.us1.advisor.ws claudegallantigprivatewealthcom.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Dec 2022 One Off
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 100 days
davedesrochers.ca davedesrochers.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 156 days
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 198 days
freemangroup.us1.advisor.ws freemangroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
gestionpriveegi.com gestionpriveegi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Feb 2019 Jul 2019 158 days
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 191 days
hopeandassociates.ca hopeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2022 147 days
igprivatewealth.com igprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Feb 2019 Jul 2019 151 days
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 186 days
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 167 days
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 143 days
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 338 days
metzgergroup.ca metzgergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 80 days
kalinkaprivatewealth.com kalinkaprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 143 days
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 205 days
kcmprivatewealth.ca kcmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 85 days
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
markewert.us1.advisor.ws markewert.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 163 days
millarddawes.com millarddawes.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 161 days
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 21 days
nolintoogood.ca nolintoogood.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 77 days
nturner.us1.advisor.ws nturner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 156 days
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 16 days
investorsgroup.com advisor.investorsgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Dec 2016 Sep 2017 257 days
seeleygroup.ca seeleygroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2023 8 days
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 108 days
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 214 days
spenceandassociatespwm.com spenceandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
taylorzapotoczny.us1.advisor.ws taylorzapotoczny.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Jun 2022 One Off
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 227 days
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 59 days
walshmckenziedegroot.com walshmckenziedegroot.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 58 days
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 354 days
claudegallantandassociates.com claudegallantandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 204 days
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 204 days
igfr.us1.advisor.ws igfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Nov 2022 Dec 2022 48 days
investorsgroup.ca investorsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Apr 2017 316 days
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 36 days
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
greengrouppwm.com greengrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Oct 2023 212 days
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 191 days
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 11 days
rawlukprivatewealth.com rawlukprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 148 days
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 9 days
rspence.us1.advisor.ws rspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 8 days
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 145 days
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 144 days
scottsyrja.com scottsyrja.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 6 days
taylorzapotoczny.com taylorzapotoczny.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
themorristeam.ca themorristeam.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
groupeinvestors.com conseiller.groupeinvestors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Dec 2016 Sep 2017 257 days
davidhames.ca davidhames.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
dhames.us1.advisor.ws dhames.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 200 days
equipegilbertpereira.com equipegilbertpereira.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Oct 2023 1 year, 51 days
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 196 days
esserprivatewealth.com esserprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 196 days
foxrevettassociates.com foxrevettassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 193 days
gobelandassociates.com gobelandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 191 days
groupe-investors.ca groupe-investors.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Oct 2017 1 year, 114 days
groupeinvestors.ca groupeinvestors.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Apr 2017 299 days
groupeinvestors.com groupeinvestors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Aug 2018 2 years, 79 days
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 188 days
johncornwallandassociates.com johncornwallandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 168 days
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 167 days
kjonesandassociates.ca kjonesandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2022 One Off
lacassedelarierafr.us1.advisor.ws lacassedelarierafr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2023 97 days
larmandgroup.com larmandgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 166 days
mabeeandassociatespwm.com mabeeandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 164 days
marcovendramini.com marcovendramini.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 126 days
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 80 days
naultgrouppwm.ca naultgrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 158 days
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 158 days
investorsgroup.com promo.investorsgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Mar 2017 Sep 2017 191 days
bayandassociates.ca bayandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2023 338 days
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 209 days
syrja.ca syrja.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
lacassedelariera.com lacassedelariera.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 166 days
karenandkayla.ca karenandkayla.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 167 days
dennishuntandassociates.ca dennishuntandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
sandraramosandassociates.ca sandraramosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2023 8 days
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 6 days
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2023 7 days
sifnakisgroup.com sifnakisgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2023 125 days
solutionsbanking.org solutionsbanking.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Apr 2017 299 days
thomassavage.ca thomassavage.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023 1 year, 229 days
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 116 days
wheelermcivor.ca wheelermcivor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2023 58 days
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Oct 2023 103 days
paulvaillancourt.com fr.paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Feb 2023 81 days
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2023 One Off
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2023 Oct 2023 40 days
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 199 days
elevateyourwealth.ca elevateyourwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2023 153 days
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 195 days
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 193 days
gaylortachauer.ca gaylortachauer.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 192 days
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023 206 days
investorsgroup.com investorsgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-2868753 Jun 2016 Jul 2019 3 years, 33 days
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 166 days
lalliandassociates.com lalliandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 141 days
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year, 24 days
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 158 days
osmondfindlay.ca osmondfindlay.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2023 15 days
rapwm.com rapwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 138 days
kapwm.ca kapwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Oct 2023 303 days
daviesmahnke.com daviesmahnke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
donnellygrouppwm.com donnellygrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 199 days
dawsonandassociatespwm.com dawsonandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 199 days
TRANTERANDASSOCIATESPRIVATEWEALTHMANAGEMENT.COM
Non IP Attributes
Attribute First Last
UA UA-2868753 Jun 2016 Jul 2019
UA UA-67387079 Jun 2016 Jul 2019
UA UA-72991320 Jun 2016 Jul 2019
SC SC-INVESTORSGRIG.COMPROD Mar 2022 Oct 2023
GTM GTM-G-0FSFL4QW1Q Nov 2022 May 2023
TRANTERANDASSOCIATESPRIVATEWEALTHMANAGEMENT.COM
Overlap Attribute Domains
irenevassalo.com irenevassalo.com
reishelpwm.com reishelpwm.com
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
kudrowichpwm.com kudrowichpwm.com
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
vignoneassociatespwm.com vignoneassociatespwm.com
garofaloandassociates.ca garofaloandassociates.ca
kevinkaiser.ca kevinkaiser.ca
landriaultpwm.com landriaultpwm.com
mignaultprivatewealth.com mignaultprivatewealth.com
peterdefrancesco.com peterdefrancesco.com
powellpwm.com powellpwm.com
dehartandassociates.com dehartandassociates.com
edbootle.ca edbootle.ca
johnmazziotti.com johnmazziotti.com
flanaganandassociates.ca flanaganandassociates.ca
girardandassociates.com girardandassociates.com
richardwutzke.com richardwutzke.com
robeby.com robeby.com
toddandassociatespwm.com toddandassociatespwm.com
elaineandrewandassociates.com elaineandrewandassociates.com
leboeufpwm.com leboeufpwm.com
loweandassociates.ca loweandassociates.ca
macdougallandmaticpwm.com macdougallandmaticpwm.com
nolinandassociatespwm.com nolinandassociatespwm.com
markewert.com markewert.com
scepanovicandassociates.com scepanovicandassociates.com
shirleyhill.net shirleyhill.net
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
leavittgroup.ca leavittgroup.ca
michelberniergpp.com michelberniergpp.com
pwmwebbuilder.com pwmwebbuilder.com
dirobinsonandassociates.com dirobinsonandassociates.com
fayeafshar.com fayeafshar.com
gibbingsandassociates.com gibbingsandassociates.com
brianwalkerprivatewealth.com brianwalkerprivatewealth.com
equipemarcantoinereid.com equipemarcantoinereid.com
equipesimonaube.com equipesimonaube.com
joelbraypwm.com joelbraypwm.com
robdaumler.com robdaumler.com
fredkolodrubsky.ca fredkolodrubsky.ca
geeandassociates.ca geeandassociates.ca
paulvaillancourt.com paulvaillancourt.com
loretoryder.com loretoryder.com
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
mehrotragroup.com mehrotragroup.com
mertenswealth.com mertenswealth.com
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
mielefinancialgroup.ca mielefinancialgroup.ca
paziukandassociates.com paziukandassociates.com
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
rickdellpwm.com rickdellpwm.com
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
rprobinsonpwm.ca rprobinsonpwm.ca
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
agrawalassociates.ca agrawalassociates.ca
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
sylvielefebvre.com sylvielefebvre.com
thekilgourgroup.com thekilgourgroup.com
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
tobacpwm.com tobacpwm.com
bcbgestionprivee.com bcbgestionprivee.com
trudybuttandassociates.com trudybuttandassociates.com
benkeandassociates.com benkeandassociates.com
bourgeaultandassociates.com bourgeaultandassociates.com
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
brunotherrien.us1.advisor.ws brunotherrien.us1.advisor.ws
buhrblaylock.com buhrblaylock.com
wolkerandassociatespwm.com wolkerandassociatespwm.com
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
zarnlochheadpwm.com zarnlochheadpwm.com
chiodobirkettandassociates.com chiodobirkettandassociates.com
chmprivatewealth.ca chmprivatewealth.ca
claudegallant.com claudegallant.com
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
courcellesgroup.com courcellesgroup.com
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
equipedaoust.ca equipedaoust.ca
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
equipemicheldesbiens.com equipemicheldesbiens.com
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
farrowandassociatespwm.com farrowandassociatespwm.com
finchgoodale.com finchgoodale.com
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
floermillikengroup.com floermillikengroup.com
freemangroup.ca freemangroup.ca
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
jeffsomerspwm.com jeffsomerspwm.com
jenningsandassociates.ca jenningsandassociates.ca
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
juddbissonandassociates.com juddbissonandassociates.com
karasickprivatewealth.com karasickprivatewealth.com
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
lehouxgestionprivee.com lehouxgestionprivee.com
lisabell.ca lisabell.ca
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
loboandassociatespwm.ca loboandassociatespwm.ca
macmahonandassociates.com macmahonandassociates.com
mhmprivatewealth.com mhmprivatewealth.com
milesschiller.com milesschiller.com
milngroup.com milngroup.com
mondouetassocies.com mondouetassocies.com
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
princeandassociates.ca princeandassociates.ca
ramoslaine.com ramoslaine.com
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
ryangroupwealth.com ryangroupwealth.com
schillerspence.ca schillerspence.ca
agbaileyandassociates.com agbaileyandassociates.com
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
sergiosalina.com sergiosalina.com
snowandassociatespwm.com snowandassociatespwm.com
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
stevenboydpwm.com stevenboydpwm.com
strussanddennyprivatewealthmanagement.com strussanddennyprivatewealthmanagement.com
teamlacassestephens.com teamlacassestephens.com
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
vickendurgerian.com vickendurgerian.com
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
brodieandassociates.com brodieandassociates.com
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
carneylyster.com carneylyster.com
carterprivatewealth.com carterprivatewealth.com
charbonneauetassocies.ca charbonneauetassocies.ca
colbournegroup.com colbournegroup.com
coleentaylor.ca coleentaylor.ca
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
donfox.net donfox.net
elliottchaulk.com elliottchaulk.com
equipemichelcote.com equipemichelcote.com
equipetremblay.com equipetremblay.com
gabechiodo.ca gabechiodo.ca
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
ginettebradette.ca ginettebradette.ca
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
harveypwm.ca harveypwm.ca
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
jasondaleo.ca jasondaleo.ca
jbfgroup.ca jbfgroup.ca
jennerandassociates.com jennerandassociates.com
jenningsgroup.ca jenningsgroup.ca
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
roesthovesquire.ca roesthovesquire.ca
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
sylvainmorin.ca sylvainmorin.ca
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
thiessenpwm.com thiessenpwm.com
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
tmassociates.ca tmassociates.ca
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
blackbelyea.com blackbelyea.com
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
wannerandassociates.ca wannerandassociates.ca
brentmacdonald.ca brentmacdonald.ca
wherryandassociates.ca wherryandassociates.ca
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
woodwardandassociates.ca woodwardandassociates.ca
carneywealthmanagement.com carneywealthmanagement.com
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
costantinigroup.ca costantinigroup.ca
dallaireandassociates.ca dallaireandassociates.ca
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
danylukandassociates.com danylukandassociates.com
ddkpwm.ca ddkpwm.ca
demersandassociates.ca demersandassociates.ca
donfox.us1.advisor.ws donfox.us1.advisor.ws
dupuispwm.com dupuispwm.com
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
equipealainbrunet.com equipealainbrunet.com
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
equipeyanickjuneau.ca equipeyanickjuneau.ca
floerfarrowpwm.com floerfarrowpwm.com
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
gerberteam.com gerberteam.com
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
godwinandassociates.ca godwinandassociates.ca
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
hoffmangrouppwm.ca hoffmangrouppwm.ca
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
jasonblucke.com jasonblucke.com
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
jeffsmithpwm.ca jeffsmithpwm.ca
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
kenwardgrouppwm.com kenwardgrouppwm.com
kucherawyandassociates.ca kucherawyandassociates.ca
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
lylekarasick.com lylekarasick.com
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
normanpiche.ca normanpiche.ca
oxleymetzgerpwm.com oxleymetzgerpwm.com
pentzwebsterandassociates.com pentzwebsterandassociates.com
philippedumont.com philippedumont.com
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
pompu.ca pompu.ca
robeby.us1.advisor.ws robeby.us1.advisor.ws
runzerandassociates.com runzerandassociates.com
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
santosandassociates.ca santosandassociates.ca
sharmaandassociatespwm.com sharmaandassociatespwm.com
anna-marierasmussen.ca anna-marierasmussen.ca
squireassociates.ca squireassociates.ca
stranskyandassociates.ca stranskyandassociates.ca
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
thlprivatewealth.com thlprivatewealth.com
bastgroup.ca bastgroup.ca
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
brunotherrien.ca brunotherrien.ca
dalesmallgroup.ca dalesmallgroup.ca
deprezandassociates.com deprezandassociates.com
desfossesgoulet.ca desfossesgoulet.ca
equipedbergeron.com equipedbergeron.com
equipejeanthomasmenard.com equipejeanthomasmenard.com
equipelaforme.com equipelaforme.com
equipelptoupin.ca equipelptoupin.ca
gillickandassociatespwm.com gillickandassociatespwm.com
greghillaby.com greghillaby.com
hallamandassociates.com hallamandassociates.com
hansonprivatewealth.ca hansonprivatewealth.ca
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
jonwhiteheadandassociates.com jonwhiteheadandassociates.com
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
jwrossandassociates.ca jwrossandassociates.ca
kathyduguaypwm.com kathyduguaypwm.com
kenhendriks.com kenhendriks.com
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
marianasemenchuk.com marianasemenchuk.com
marioloreto.com marioloreto.com
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
mcinroypwm.com mcinroypwm.com
methorstandassociates.ca methorstandassociates.ca
mhmrpwm.ca mhmrpwm.ca
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
oconnorandassociates.ca oconnorandassociates.ca
lovisandassociates.com lovisandassociates.com
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
nathalygagnon.com nathalygagnon.com
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
russjennings.ca russjennings.ca
seeleyandshoemaker.com seeleyandshoemaker.com
simundsonandassociates.ca simundsonandassociates.ca
solutionsbanking.ca solutionsbanking.ca
stevensandassociates.ca stevensandassociates.ca
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
cameronrennieandassociates.com cameronrennieandassociates.com
fr.nathalygagnon.com fr.nathalygagnon.com
claudegallantigprivatewealthcom.us1.advisor.ws claudegallantigprivatewealthcom.us1.advisor.ws
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
davedesrochers.ca davedesrochers.ca
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
freemangroup.us1.advisor.ws freemangroup.us1.advisor.ws
gestionpriveegi.com gestionpriveegi.com
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
hopeandassociates.ca hopeandassociates.ca
igprivatewealth.com igprivatewealth.com
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
metzgergroup.ca metzgergroup.ca
kalinkaprivatewealth.com kalinkaprivatewealth.com
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
kcmprivatewealth.ca kcmprivatewealth.ca
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
markewert.us1.advisor.ws markewert.us1.advisor.ws
millarddawes.com millarddawes.com
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
nolintoogood.ca nolintoogood.ca
nturner.us1.advisor.ws nturner.us1.advisor.ws
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
advisor.investorsgroup.com advisor.investorsgroup.com
seeleygroup.ca seeleygroup.ca
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
spenceandassociatespwm.com spenceandassociatespwm.com
taylorzapotoczny.us1.advisor.ws taylorzapotoczny.us1.advisor.ws
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
walshmckenziedegroot.com walshmckenziedegroot.com
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
claudegallantandassociates.com claudegallantandassociates.com
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
igfr.us1.advisor.ws igfr.us1.advisor.ws
investorsgroup.ca investorsgroup.ca
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
greengrouppwm.com greengrouppwm.com
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
rawlukprivatewealth.com rawlukprivatewealth.com
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
rspence.us1.advisor.ws rspence.us1.advisor.ws
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
scottsyrja.com scottsyrja.com
taylorzapotoczny.com taylorzapotoczny.com
themorristeam.ca themorristeam.ca
conseiller.groupeinvestors.com conseiller.groupeinvestors.com
davidhames.ca davidhames.ca
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
dhames.us1.advisor.ws dhames.us1.advisor.ws
equipegilbertpereira.com equipegilbertpereira.com
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
esserprivatewealth.com esserprivatewealth.com
foxrevettassociates.com foxrevettassociates.com
gobelandassociates.com gobelandassociates.com
groupe-investors.ca groupe-investors.ca
groupeinvestors.ca groupeinvestors.ca
groupeinvestors.com groupeinvestors.com
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
johncornwallandassociates.com johncornwallandassociates.com
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
kjonesandassociates.ca kjonesandassociates.ca
lacassedelarierafr.us1.advisor.ws lacassedelarierafr.us1.advisor.ws
larmandgroup.com larmandgroup.com
mabeeandassociatespwm.com mabeeandassociatespwm.com
marcovendramini.com marcovendramini.com
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
naultgrouppwm.ca naultgrouppwm.ca
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
promo.investorsgroup.com promo.investorsgroup.com
bayandassociates.ca bayandassociates.ca
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
syrja.ca syrja.ca
lacassedelariera.com lacassedelariera.com
karenandkayla.ca karenandkayla.ca
dennishuntandassociates.ca dennishuntandassociates.ca
sandraramosandassociates.ca sandraramosandassociates.ca
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
sifnakisgroup.com sifnakisgroup.com
solutionsbanking.org solutionsbanking.org
thomassavage.ca thomassavage.ca
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
wheelermcivor.ca wheelermcivor.ca
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
fr.paulvaillancourt.com fr.paulvaillancourt.com
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
elevateyourwealth.ca elevateyourwealth.ca
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
gaylortachauer.ca gaylortachauer.ca
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
investorsgroup.com investorsgroup.com
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
lalliandassociates.com lalliandassociates.com
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
osmondfindlay.ca osmondfindlay.ca
rapwm.com rapwm.com
kapwm.ca kapwm.ca
daviesmahnke.com daviesmahnke.com
donnellygrouppwm.com donnellygrouppwm.com
dawsonandassociatespwm.com dawsonandassociatespwm.com
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
TRANTERANDASSOCIATESPRIVATEWEALTHMANAGEMENT.COM
IP History

Click the IP addresses to see over domains using them.