Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

MEHROTRAGROUP.COM

MEHROTRAGROUP.COM
Shared Attributes
Domain
kudrowichpwm.com kudrowichpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Dec 2024 1 year, 329 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 187 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 161 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 17 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
mertenswealth.com mertenswealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 14 days
mielefinancialgroup.ca mielefinancialgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 14 days
freemangroup.ca freemangroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 15 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 13 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 11 days
farrowandassociatespwm.com farrowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 178 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 11 days
finchgoodale.com finchgoodale.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jan 2025 1 year, 239 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 11 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
agrawalassociates.ca agrawalassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 28 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 163 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 14 days
kevinkaiser.ca kevinkaiser.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Dec 2024 1 year, 327 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
landriaultpwm.com landriaultpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jan 2025 1 year, 296 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 64 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 8 days
jenningsgroup.ca jenningsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
loboandassociatespwm.ca loboandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 189 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 13 days
jennerandassociates.com jennerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 185 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
milngroup.com milngroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 25 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
gabechiodo.ca gabechiodo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jan 2025 1 year, 255 days
GTM GTM-G-0FSFL4QW1Q May 2023 Jun 2023 34 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Mar 2023 100 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 5 days
charbonneauetassocies.ca charbonneauetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
blackbelyea.com blackbelyea.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 30 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Mar 2023 95 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
danylukandassociates.com danylukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
equipemarcantoinereid.com equipemarcantoinereid.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 11 days
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 14 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
kenwardgrouppwm.com kenwardgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2024 1 year, 239 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 17 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 94 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 14 days
loweandassociates.ca loweandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 25 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 156 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 14 days
marianasemenchuk.com marianasemenchuk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 17 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 14 days
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 17 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 190 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 14 days
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 29 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 154 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
mhmrpwm.ca mhmrpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
bastgroup.ca bastgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 29 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 190 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
hansonprivatewealth.ca hansonprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
brunotherrien.ca brunotherrien.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 30 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
macdougallandmaticpwm.com macdougallandmaticpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 186 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 190 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
jwrossandassociates.ca jwrossandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 186 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 5 days
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 188 days
loretoryder.com loretoryder.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 25 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 189 days
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 135 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 155 days
dargisgroup.ca dargisgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 205 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 10 days
daumlermertzwealth.ca daumlermertzwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2024 Feb 2025 77 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 10 days
paziukandassociates.com paziukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 271 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
cheungprivatewealth.ca cheungprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
SC SC-INVESTORSGRIG.COMPROD Feb 2025 Feb 2025 One Off
mauriziomastroianni.com mauriziomastroianni.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Feb 2025 271 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 14 days
equipesoniagosselin.ca equipesoniagosselin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Feb 2025 109 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 209 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 135 days
rickdellpwm.com rickdellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 272 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 185 days
metzgergroup.ca metzgergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Feb 2025 1 year, 184 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 6 days
jonathandaviespwm.ca jonathandaviespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 275 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 13 days
bcbgestionprivee.com bcbgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Nov 2024 1 year, 118 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Sep 2024 1 year, 252 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 135 days
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 209 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Sep 2024 1 year, 255 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 132 days
markewert.com markewert.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jan 2025 1 year, 289 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2023 24 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
sylvielefebvre.com sylvielefebvre.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 149 days
thekilgourgroup.com thekilgourgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 140 days
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 270 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
tobacpwm.com tobacpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 274 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
trudybuttandassociates.com trudybuttandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 274 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
vignoneassociatespwm.com vignoneassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 275 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 180 days
bourgeaultandassociates.com bourgeaultandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 30 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 136 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
buhrblaylock.com buhrblaylock.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 30 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 232 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 157 days
zarnlochheadpwm.com zarnlochheadpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2024 1 year, 155 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 38 days
chiodobirkettandassociates.com chiodobirkettandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Mar 2023 112 days
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Mar 2023 62 days
chmprivatewealth.ca chmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 170 days
claudegallant.com claudegallant.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 180 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 167 days
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
courcellesgroup.com courcellesgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 172 days
equipedaoust.ca equipedaoust.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Feb 2025 1 year, 322 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 66 days
equipemicheldesbiens.com equipemicheldesbiens.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 177 days
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Mar 2023 101 days
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Mar 2023 76 days
floermillikengroup.com floermillikengroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 179 days
garofaloandassociates.ca garofaloandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 183 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 183 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
jeffsomerspwm.com jeffsomerspwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2023 205 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 185 days
jenningsandassociates.ca jenningsandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Apr 2023 86 days
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 185 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 160 days
juddbissonandassociates.com juddbissonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 186 days
kalinkaprivatewealth.com kalinkaprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Feb 2025 1 year, 240 days
GTM GTM-G-0FSFL4QW1Q Jun 2023 Jun 2023 5 days
karasickprivatewealth.com karasickprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2023 149 days
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 194 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 186 days
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 185 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 159 days
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 204 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 160 days
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 187 days
leavittgroup.ca leavittgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 25 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
lehouxgestionprivee.com lehouxgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 25 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 188 days
lisabell.ca lisabell.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 128 days
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Apr 2023 91 days
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 95 days
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Apr 2023 91 days
macmahonandassociates.com macmahonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 190 days
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2023 153 days
mignaultprivatewealth.com mignaultprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 150 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
mondouetassocies.com mondouetassocies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 225 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
gibbingsandassociates.com gibbingsandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
mariodufouretassociees.ca mariodufouretassociees.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 214 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 14 days
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 136 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Apr 2023 90 days
peterdefrancesco.com peterdefrancesco.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 271 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 187 days
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 139 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 142 days
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2023 12 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 152 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
powellpwm.com powellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 271 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 187 days
princeandassociates.ca princeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 256 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 139 days
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 209 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 135 days
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Sep 2024 1 year, 251 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 135 days
ryangroupwealth.com ryangroupwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 272 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 184 days
schillerspence.ca schillerspence.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 250 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 147 days
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2024 1 year, 36 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 132 days
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 284 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
snowandassociatespwm.com snowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 272 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 183 days
mcgrathandassociateswm.com mcgrathandassociateswm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 226 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Sep 2024 1 year, 262 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Apr 2023 83 days
stevenboydpwm.com stevenboydpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 182 days
michelleboeuf.us1.advisor.ws michelleboeuf.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 284 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 231 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 81 days
vickendurgerian.com vickendurgerian.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2024 1 year, 158 days
GTM GTM-G-0FSFL4QW1Q May 2023 Jun 2023 26 days
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2023 Jul 2024 1 year, 135 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 78 days
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 137 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 137 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 168 days
brodieandassociates.com brodieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 30 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 278 days
GTM GTM-G-0FSFL4QW1Q May 2023 May 2023 One Off
carneylyster.com carneylyster.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 21 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 169 days
carterprivatewealth.com carterprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
colbournegroup.com colbournegroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Feb 2025 1 year, 332 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 147 days
coleentaylor.ca coleentaylor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Nov 2023 317 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 219 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 219 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
dehartandassociates.com dehartandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 173 days
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 181 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
donfox.net donfox.net
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 19 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 186 days
edbootle.ca edbootle.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
elliottchaulk.com elliottchaulk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
equipetremblay.com equipetremblay.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
anholtgroup.ca anholtgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Feb 2025 1 year, 89 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 54 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 Mar 2023 One Off
ginettebradette.ca ginettebradette.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Dec 2023 334 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
harveypwm.ca harveypwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 182 days
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 184 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 162 days
irenevassalo.com irenevassalo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 184 days
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 133 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 185 days
jasondaleo.ca jasondaleo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 260 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 69 days
johnmazziotti.com johnmazziotti.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 160 days
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 281 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 137 days
roesthovesquire.ca roesthovesquire.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 162 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 44 days
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 139 days
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 154 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
sylvainmorin.ca sylvainmorin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 181 days
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 154 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 149 days
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 149 days
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2023 112 days
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 269 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 81 days
thiessenpwm.com thiessenpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 178 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Mar 2023 93 days
tmassociates.ca tmassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 274 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 180 days
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 272 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 May 2023 80 days
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Mar 2024 1 year, 61 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
wannerandassociates.ca wannerandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 277 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 181 days
brentmacdonald.ca brentmacdonald.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 30 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 168 days
wherryandassociates.ca wherryandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 278 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 181 days
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 71 days
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 176 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 156 days
woodwardandassociates.ca woodwardandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 274 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 217 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
costantinigroup.ca costantinigroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
dallaireandassociates.ca dallaireandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 147 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
ddkpwm.ca ddkpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 19 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
donfox.us1.advisor.ws donfox.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 151 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
dupuispwm.com dupuispwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 175 days
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 182 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 8 days
equipealainbrunet.com equipealainbrunet.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 182 days
equipesimonaube.com equipesimonaube.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 155 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipeyanickjuneau.ca equipeyanickjuneau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 182 days
flanaganandassociates.ca flanaganandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Dec 2023 330 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 178 days
floerfarrowpwm.com floerfarrowpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Sep 2023 257 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 12 days
gerberteam.com gerberteam.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
girardandassociates.com girardandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 176 days
godwinandassociates.ca godwinandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 180 days
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Dec 2023 339 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
hoffmangrouppwm.ca hoffmangrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 182 days
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 133 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 161 days
jasonblucke.com jasonblucke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 185 days
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 185 days
jeffsmithpwm.ca jeffsmithpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 185 days
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 185 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 26 days
kucherawyandassociates.ca kucherawyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Apr 2023 One Off
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 185 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 159 days
marcovendramini.com marcovendramini.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 125 days
SC SC-INVESTORSGRIG.COMPROD Dec 2024 Dec 2024 One Off
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 155 days
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jun 2024 1 year, 75 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 61 days
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 221 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2024 1 year, 14 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 147 days
pentzwebsterandassociates.com pentzwebsterandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 170 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 150 days
philippedumont.com philippedumont.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 271 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 187 days
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 152 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 142 days
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Sep 2024 1 year, 142 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 52 days
pompu.ca pompu.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 27 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
millardwealth.com millardwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 284 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
bayandassociates.ca bayandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 29 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
mignaultbadder.ca mignaultbadder.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Feb 2025 190 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
syrja.ca syrja.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 27 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
markwebster.ca markwebster.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 271 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
karenandkayla.ca karenandkayla.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
reishelpwm.com reishelpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 271 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 166 days
equipestephanethibeault.ca equipestephanethibeault.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2024 Feb 2025 57 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 11 days
richardwutzke.com richardwutzke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 272 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 185 days
robeby.com robeby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 19 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
robeby.us1.advisor.ws robeby.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 19 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 135 days
runzerandassociates.com runzerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2024 1 year, 107 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 56 days
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Sep 2024 1 year, 253 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 134 days
lyleandassociatespwm.ca lyleandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 214 days
SC SC-investorsgrig.comprod Feb 2025 Feb 2025 One Off
santosandassociates.ca santosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 165 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 47 days
sharmaandassociatespwm.com sharmaandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 272 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 183 days
elevateyourwealth.ca elevateyourwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Feb 2025 1 year, 257 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
anna-marierasmussen.ca anna-marierasmussen.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Sep 2023 242 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 164 days
squireassociates.ca squireassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 128 days
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2023 27 days
stranskyandassociates.ca stranskyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 182 days
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Apr 2023 139 days
thlprivatewealth.com thlprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 140 days
toddandassociatespwm.com toddandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 274 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 155 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Feb 2023 One Off
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 292 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 179 days
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Feb 2023 74 days
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2023 37 days
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 136 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 168 days
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 120 days
GTM GTM-G-0FSFL4QW1Q Mar 2023 May 2023 72 days
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Nov 2024 1 year, 297 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Mar 2023 97 days
dalesmallgroup.ca dalesmallgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 May 2023 173 days
deprezandassociates.com deprezandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 188 days
desfossesgoulet.ca desfossesgoulet.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
elaineandrewandassociates.com elaineandrewandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
equipejeanthomasmenard.com equipejeanthomasmenard.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
equipelaforme.com equipelaforme.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
equipelptoupin.ca equipelptoupin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 One Off
greghillaby.com greghillaby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Jan 2025 1 year, 244 days
GTM GTM-G-0FSFL4QW1Q Apr 2023 Jun 2023 72 days
hallamandassociates.com hallamandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 181 days
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 134 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 161 days
geeandassociates.ca geeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 22 days
SC SC-investorsgrig.comprod Jan 2025 Jan 2025 4 days
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 192 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 160 days
kathyduguaypwm.com kathyduguaypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Feb 2025 1 year, 301 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Jun 2023 116 days
leboeufpwm.com leboeufpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 188 days
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 168 days
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 191 days
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 169 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 155 days
mcinroypwm.com mcinroypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Feb 2025 1 year, 301 days
GTM GTM-G-0FSFL4QW1Q Feb 2023 Jun 2023 113 days
methorstandassociates.ca methorstandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 154 days
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2023 5 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
kapwm.ca kapwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 18 days
SC SC-investorsgrig.comprod Jan 2025 Feb 2025 14 days
nolinandassociatespwm.com nolinandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2023 158 days
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jun 2023 151 days
larouchepwm.ca larouchepwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Feb 2025 167 days
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 225 days
nathalygagnon.com nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 270 days
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 May 2024 226 days
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 209 days
sajoetassocies.ca sajoetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Oct 2024 13 days
salsbury.ca salsbury.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2024 Oct 2024 238 days
scepanovicandassociates.com scepanovicandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 272 days
seeleyandshoemaker.com seeleyandshoemaker.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 229 days
sharifosterandassociates.ca sharifosterandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Oct 2024 119 days
simundsonandassociates.ca simundsonandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 163 days
slaunwhiteandassociates.ca slaunwhiteandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Oct 2024 99 days
stephenstruthers.us1.advisor.ws stephenstruthers.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Aug 2024 97 days
stevensandassociates.ca stevensandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 351 days
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 154 days
baileyassociates.ca baileyassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Feb 2025 262 days
beaulieulebuis.com beaulieulebuis.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 302 days
benkeandassociates.com benkeandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Apr 2024 1 year, 92 days
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Mar 2024 1 year, 57 days
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 179 days
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 278 days
wolkerandassociatespwm.com wolkerandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 274 days
cameronrennieandassociates.com cameronrennieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Feb 2025 1 year, 206 days
nathalygagnon.com fr.nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jan 2023 38 days
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Aug 2024 1 year, 26 days
davedesrochers.ca davedesrochers.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Feb 2025 1 year, 260 days
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 147 days
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 219 days
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 219 days
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
fredpentz.us1.advisor.ws fredpentz.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jan 2025 252 days
gagrawal.us1.advisor.ws gagrawal.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 93 days
garofalodonato.ca garofalodonato.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Jan 2025 167 days
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 25 days
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 194 days
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Dec 2023 201 days
kennedyassociateswm.us1.advisor.ws kennedyassociateswm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 112 days
krallwilliamsgroup.ca krallwilliamsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2025 Feb 2025 One Off
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 29 days
anjalijensen.com anjalijensen.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 309 days
bowtellandassociate.ca bowtellandassociate.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Feb 2025 110 days
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 29 days
canningandpoolegroup.ca canningandpoolegroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Feb 2025 216 days
chevaliermccorristonandassociates.ca chevaliermccorristonandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2025 Feb 2025 10 days
chsmwealth.ca chsmwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Feb 2025 254 days
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 107 days
kcmprivatewealth.ca kcmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Feb 2025 1 year, 182 days
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
lerouxpepin.ca lerouxpepin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Feb 2025 135 days
markewert.us1.advisor.ws markewert.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 168 days
millarddawes.com millarddawes.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2024 1 year, 5 days
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 226 days
nolintoogood.ca nolintoogood.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2024 1 year, 55 days
nturner.us1.advisor.ws nturner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Sep 2024 1 year, 257 days
paughcarlsonwealth.ca paughcarlsonwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Sep 2024 88 days
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 136 days
potvinlemayetassocies.ca potvinlemayetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Oct 2024 13 days
samuelswealth.ca samuelswealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Oct 2024 13 days
seeleygroup.ca seeleygroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 353 days
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Nov 2023 121 days
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 128 days
spenceandassociatespwm.com spenceandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 114 days
stephenjudd.us1.advisor.ws stephenjudd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Sep 2024 148 days
beginbattinggroup.ca beginbattinggroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Feb 2025 276 days
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Mar 2024 1 year, 60 days
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Mar 2024 194 days
vinerandselig.ca vinerandselig.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Oct 2024 100 days
walshmckenziedegroot.com walshmckenziedegroot.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2024 1 year, 43 days
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 278 days
gallantgrouppwm.com fr.gallantgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Nov 2024 50 days
clairehallam.us1.advisor.ws clairehallam.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 110 days
claudegallantandassociates.com claudegallantandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 180 days
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 218 days
desrochersassociates.us1.advisor.ws desrochersassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jun 2024 40 days
equipelangevin.ca equipelangevin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2024 Feb 2025 62 days
equipeyl.ca equipeyl.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 287 days
igfr.us1.advisor.ws igfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 21 days
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 134 days
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 134 days
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
equipetgt.ca equipetgt.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Feb 2025 130 days
greengrouppwm.com greengrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jan 2025 1 year, 308 days
huebertandassociates.com huebertandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 279 days
clayfung.ca clayfung.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Feb 2025 1 year, 82 days
hopkinspopeandassociates.ca hopkinspopeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 210 days
fayeafshar.com fayeafshar.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 12 days
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
lylekarasick.com lylekarasick.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jan 2023 36 days
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Jan 2023 Jan 2023 One Off
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Sep 2024 1 year, 250 days
rawlukprivatewealth.com rawlukprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 271 days
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 209 days
rspence.us1.advisor.ws rspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 272 days
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Sep 2024 1 year, 255 days
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 229 days
scottsyrja.com scottsyrja.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 153 days
alonsoyuffeandassociates.ca alonsoyuffeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Feb 2025 178 days
spencelockiegroup.ca spencelockiegroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Oct 2024 147 days
taylorzapotoczny.com taylorzapotoczny.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
themorristeam.ca themorristeam.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
wiartpearsonakle.com wiartpearsonakle.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Oct 2024 162 days
davidhames.ca davidhames.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 1 year, 361 days
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 147 days
dhames.us1.advisor.ws dhames.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 181 days
duanerunzer.us1.advisor.ws duanerunzer.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 110 days
equipeannegrypinich.ca equipeannegrypinich.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2025 Feb 2025 35 days
equipegilbertpereira.com equipegilbertpereira.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 2 days
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 182 days
esserprivatewealth.com esserprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
foxrevettassociates.com foxrevettassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 22 days
gobelandassociates.com gobelandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 175 days
hopebirkettdawson.ca hopebirkettdawson.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 185 days
kboudreauandassociates.ca kboudreauandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Feb 2025 185 days
johncornwallandassociates.com johncornwallandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 194 days
karlchoquettegestionprivee.ca karlchoquettegestionprivee.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 241 days
larmandgroup.com larmandgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 25 days
mabeeandassociatespwm.com mabeeandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2024 358 days
mastroianniassociatespwm.us1.advisor.ws mastroianniassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 114 days
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 May 2024 288 days
naultgrouppwm.ca naultgrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 270 days
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 231 days
osmondfindlay.us1.advisor.ws osmondfindlay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2024 May 2024 118 days
berardinelligroup.com berardinelligroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 302 days
amandagraham-rowe.com amandagraham-rowe.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Feb 2025 265 days
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 30 days
bouwmeestergroup.ca bouwmeestergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 299 days
dumitruflanaganandassociates.com dumitruflanaganandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 287 days
gallantgrouppwm.com gallantgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Jan 2025 167 days
lacassedelariera.com lacassedelariera.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 24 days
dennishuntandassociates.ca dennishuntandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
dewashrafandassociates.ca dewashrafandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 251 days
robdaumler.com robdaumler.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 272 days
saccoandassociates.ca saccoandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Oct 2024 44 days
sandraramosandassociates.ca sandraramosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 353 days
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2024 1 year, 36 days
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 352 days
sidarosetassocies.ca sidarosetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Oct 2024 134 days
sifnakisgroup.com sifnakisgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2024 1 year, 105 days
slaunwhiteassociates.us1.advisor.ws slaunwhiteassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Sep 2024 145 days
anholtgrouppwm.us1.advisor.ws anholtgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Aug 2024 98 days
angelomanzo.com angelomanzo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 309 days
backup002.us1.advisor.ws backup002.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jun 2024 30 days
thomassavage.ca thomassavage.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 273 days
vanderschuitlamb.ca vanderschuitlamb.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Oct 2024 99 days
wanandassociates.com wanandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Oct 2024 346 days
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Mar 2024 253 days
wheelermcivor.ca wheelermcivor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2024 1 year, 44 days
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Aug 2024 1 year, 28 days
paulvaillancourt.com fr.paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Feb 2023 81 days
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2023 One Off
csmprivatewealth.ca csmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Feb 2025 216 days
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2023 Aug 2024 332 days
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 181 days
engeviksaleskigroup.com engeviksaleskigroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Feb 2025 214 days
equipebenoitlauzon.ca equipebenoitlauzon.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 250 days
equipefrancismarleau.ca equipefrancismarleau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 250 days
evanriddell.com evanriddell.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2023 Aug 2024 259 days
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 158 days
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 May 2024 1 year, 132 days
gaylortachauer.ca gaylortachauer.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years, 23 days
hagueandassociates.ca hagueandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Jan 2025 135 days
halsimonson.ca halsimonson.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 278 days
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Dec 2022 One Off
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023 183 days
jasonblucke.us1.advisor.ws jasonblucke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Feb 2025 135 days
kennedyassociates.ca kennedyassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2025 Feb 2025 One Off
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 200 days
lalliandassociates.com lalliandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 267 days
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 206 days
nasonandrose.ca nasonandrose.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Oct 2024 39 days
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Aug 2024 1 year, 226 days
osmondfindlay.ca osmondfindlay.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 358 days
paulvaillancourt.com paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 271 days
rapwm.com rapwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2023 281 days
hendriksprivatewealth.ca hendriksprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Jan 2025 100 days
jesseharris.ca jesseharris.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2023 Feb 2025 1 year, 42 days
mcclureandcassar.ca mcclureandcassar.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 225 days
daviesmahnke.com daviesmahnke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
budhuandassociates.ca budhuandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Feb 2025 297 days
giannonejoncasetassocies.ca giannonejoncasetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 222 days
donnellygrouppwm.com donnellygrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
dawsonandassociatespwm.com dawsonandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025 2 years, 31 days
groupeberardinelli.com groupeberardinelli.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 270 days
groupemanzo.com groupemanzo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 278 days
dionetassocies.ca dionetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Feb 2025 251 days
MEHROTRAGROUP.COM
Non IP Attributes
Attribute First Last
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Feb 2025
GTM GTM-G-0FSFL4QW1Q Dec 2022 Jun 2023
SC SC-investorsgrig.comprod Jan 2025 Feb 2025
GTM GTM-G-FEGRJ7CK5E Feb 2025 Feb 2025
MEHROTRAGROUP.COM
Overlap Attribute Domains
mehrotragroup.com mehrotragroup.com
kudrowichpwm.com kudrowichpwm.com
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
mertenswealth.com mertenswealth.com
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
mielefinancialgroup.ca mielefinancialgroup.ca
freemangroup.ca freemangroup.ca
farrowandassociatespwm.com farrowandassociatespwm.com
finchgoodale.com finchgoodale.com
agrawalassociates.ca agrawalassociates.ca
kevinkaiser.ca kevinkaiser.ca
landriaultpwm.com landriaultpwm.com
jenningsgroup.ca jenningsgroup.ca
loboandassociatespwm.ca loboandassociatespwm.ca
jennerandassociates.com jennerandassociates.com
milngroup.com milngroup.com
gabechiodo.ca gabechiodo.ca
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
charbonneauetassocies.ca charbonneauetassocies.ca
blackbelyea.com blackbelyea.com
danylukandassociates.com danylukandassociates.com
equipemarcantoinereid.com equipemarcantoinereid.com
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
kenwardgrouppwm.com kenwardgrouppwm.com
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
loweandassociates.ca loweandassociates.ca
marianasemenchuk.com marianasemenchuk.com
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
mhmrpwm.ca mhmrpwm.ca
bastgroup.ca bastgroup.ca
hansonprivatewealth.ca hansonprivatewealth.ca
brunotherrien.ca brunotherrien.ca
macdougallandmaticpwm.com macdougallandmaticpwm.com
jwrossandassociates.ca jwrossandassociates.ca
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
loretoryder.com loretoryder.com
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
dargisgroup.ca dargisgroup.ca
daumlermertzwealth.ca daumlermertzwealth.ca
paziukandassociates.com paziukandassociates.com
cheungprivatewealth.ca cheungprivatewealth.ca
mauriziomastroianni.com mauriziomastroianni.com
equipesoniagosselin.ca equipesoniagosselin.ca
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
rickdellpwm.com rickdellpwm.com
metzgergroup.ca metzgergroup.ca
jonathandaviespwm.ca jonathandaviespwm.ca
bcbgestionprivee.com bcbgestionprivee.com
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
markewert.com markewert.com
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
sylvielefebvre.com sylvielefebvre.com
thekilgourgroup.com thekilgourgroup.com
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
tobacpwm.com tobacpwm.com
trudybuttandassociates.com trudybuttandassociates.com
vignoneassociatespwm.com vignoneassociatespwm.com
bourgeaultandassociates.com bourgeaultandassociates.com
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
buhrblaylock.com buhrblaylock.com
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
zarnlochheadpwm.com zarnlochheadpwm.com
chiodobirkettandassociates.com chiodobirkettandassociates.com
chmprivatewealth.ca chmprivatewealth.ca
claudegallant.com claudegallant.com
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
courcellesgroup.com courcellesgroup.com
equipedaoust.ca equipedaoust.ca
equipemicheldesbiens.com equipemicheldesbiens.com
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
floermillikengroup.com floermillikengroup.com
garofaloandassociates.ca garofaloandassociates.ca
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
jeffsomerspwm.com jeffsomerspwm.com
jenningsandassociates.ca jenningsandassociates.ca
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
juddbissonandassociates.com juddbissonandassociates.com
kalinkaprivatewealth.com kalinkaprivatewealth.com
karasickprivatewealth.com karasickprivatewealth.com
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
leavittgroup.ca leavittgroup.ca
lehouxgestionprivee.com lehouxgestionprivee.com
lisabell.ca lisabell.ca
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
macmahonandassociates.com macmahonandassociates.com
mignaultprivatewealth.com mignaultprivatewealth.com
mondouetassocies.com mondouetassocies.com
gibbingsandassociates.com gibbingsandassociates.com
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
mariodufouretassociees.ca mariodufouretassociees.ca
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
peterdefrancesco.com peterdefrancesco.com
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
powellpwm.com powellpwm.com
princeandassociates.ca princeandassociates.ca
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
ryangroupwealth.com ryangroupwealth.com
schillerspence.ca schillerspence.ca
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
snowandassociatespwm.com snowandassociatespwm.com
mcgrathandassociateswm.com mcgrathandassociateswm.com
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
stevenboydpwm.com stevenboydpwm.com
michelleboeuf.us1.advisor.ws michelleboeuf.us1.advisor.ws
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
vickendurgerian.com vickendurgerian.com
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
brodieandassociates.com brodieandassociates.com
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
carneylyster.com carneylyster.com
carterprivatewealth.com carterprivatewealth.com
colbournegroup.com colbournegroup.com
coleentaylor.ca coleentaylor.ca
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
dehartandassociates.com dehartandassociates.com
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
donfox.net donfox.net
edbootle.ca edbootle.ca
elliottchaulk.com elliottchaulk.com
equipetremblay.com equipetremblay.com
anholtgroup.ca anholtgroup.ca
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
ginettebradette.ca ginettebradette.ca
harveypwm.ca harveypwm.ca
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
irenevassalo.com irenevassalo.com
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
jasondaleo.ca jasondaleo.ca
johnmazziotti.com johnmazziotti.com
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
roesthovesquire.ca roesthovesquire.ca
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
sylvainmorin.ca sylvainmorin.ca
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
thiessenpwm.com thiessenpwm.com
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
tmassociates.ca tmassociates.ca
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
wannerandassociates.ca wannerandassociates.ca
brentmacdonald.ca brentmacdonald.ca
wherryandassociates.ca wherryandassociates.ca
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
woodwardandassociates.ca woodwardandassociates.ca
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
costantinigroup.ca costantinigroup.ca
dallaireandassociates.ca dallaireandassociates.ca
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
ddkpwm.ca ddkpwm.ca
donfox.us1.advisor.ws donfox.us1.advisor.ws
dupuispwm.com dupuispwm.com
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
equipealainbrunet.com equipealainbrunet.com
equipesimonaube.com equipesimonaube.com
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
equipeyanickjuneau.ca equipeyanickjuneau.ca
flanaganandassociates.ca flanaganandassociates.ca
floerfarrowpwm.com floerfarrowpwm.com
gerberteam.com gerberteam.com
girardandassociates.com girardandassociates.com
godwinandassociates.ca godwinandassociates.ca
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
hoffmangrouppwm.ca hoffmangrouppwm.ca
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
jasonblucke.com jasonblucke.com
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
jeffsmithpwm.ca jeffsmithpwm.ca
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
kucherawyandassociates.ca kucherawyandassociates.ca
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
marcovendramini.com marcovendramini.com
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
pentzwebsterandassociates.com pentzwebsterandassociates.com
philippedumont.com philippedumont.com
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
pompu.ca pompu.ca
millardwealth.com millardwealth.com
bayandassociates.ca bayandassociates.ca
mignaultbadder.ca mignaultbadder.ca
syrja.ca syrja.ca
markwebster.ca markwebster.ca
karenandkayla.ca karenandkayla.ca
reishelpwm.com reishelpwm.com
equipestephanethibeault.ca equipestephanethibeault.ca
richardwutzke.com richardwutzke.com
robeby.com robeby.com
robeby.us1.advisor.ws robeby.us1.advisor.ws
runzerandassociates.com runzerandassociates.com
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
lyleandassociatespwm.ca lyleandassociatespwm.ca
santosandassociates.ca santosandassociates.ca
sharmaandassociatespwm.com sharmaandassociatespwm.com
elevateyourwealth.ca elevateyourwealth.ca
anna-marierasmussen.ca anna-marierasmussen.ca
squireassociates.ca squireassociates.ca
stranskyandassociates.ca stranskyandassociates.ca
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
thlprivatewealth.com thlprivatewealth.com
toddandassociatespwm.com toddandassociatespwm.com
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
dalesmallgroup.ca dalesmallgroup.ca
deprezandassociates.com deprezandassociates.com
desfossesgoulet.ca desfossesgoulet.ca
elaineandrewandassociates.com elaineandrewandassociates.com
equipejeanthomasmenard.com equipejeanthomasmenard.com
equipelaforme.com equipelaforme.com
equipelptoupin.ca equipelptoupin.ca
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
greghillaby.com greghillaby.com
hallamandassociates.com hallamandassociates.com
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
geeandassociates.ca geeandassociates.ca
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
kathyduguaypwm.com kathyduguaypwm.com
leboeufpwm.com leboeufpwm.com
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
mcinroypwm.com mcinroypwm.com
methorstandassociates.ca methorstandassociates.ca
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
kapwm.ca kapwm.ca
nolinandassociatespwm.com nolinandassociatespwm.com
larouchepwm.ca larouchepwm.ca
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
nathalygagnon.com nathalygagnon.com
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
sajoetassocies.ca sajoetassocies.ca
salsbury.ca salsbury.ca
scepanovicandassociates.com scepanovicandassociates.com
seeleyandshoemaker.com seeleyandshoemaker.com
sharifosterandassociates.ca sharifosterandassociates.ca
simundsonandassociates.ca simundsonandassociates.ca
slaunwhiteandassociates.ca slaunwhiteandassociates.ca
stephenstruthers.us1.advisor.ws stephenstruthers.us1.advisor.ws
stevensandassociates.ca stevensandassociates.ca
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
baileyassociates.ca baileyassociates.ca
beaulieulebuis.com beaulieulebuis.com
benkeandassociates.com benkeandassociates.com
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
wolkerandassociatespwm.com wolkerandassociatespwm.com
cameronrennieandassociates.com cameronrennieandassociates.com
fr.nathalygagnon.com fr.nathalygagnon.com
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
davedesrochers.ca davedesrochers.ca
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
fredpentz.us1.advisor.ws fredpentz.us1.advisor.ws
gagrawal.us1.advisor.ws gagrawal.us1.advisor.ws
garofalodonato.ca garofalodonato.ca
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
kennedyassociateswm.us1.advisor.ws kennedyassociateswm.us1.advisor.ws
krallwilliamsgroup.ca krallwilliamsgroup.ca
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
anjalijensen.com anjalijensen.com
bowtellandassociate.ca bowtellandassociate.ca
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
canningandpoolegroup.ca canningandpoolegroup.ca
chevaliermccorristonandassociates.ca chevaliermccorristonandassociates.ca
chsmwealth.ca chsmwealth.ca
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
kcmprivatewealth.ca kcmprivatewealth.ca
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
lerouxpepin.ca lerouxpepin.ca
markewert.us1.advisor.ws markewert.us1.advisor.ws
millarddawes.com millarddawes.com
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
nolintoogood.ca nolintoogood.ca
nturner.us1.advisor.ws nturner.us1.advisor.ws
paughcarlsonwealth.ca paughcarlsonwealth.ca
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
potvinlemayetassocies.ca potvinlemayetassocies.ca
samuelswealth.ca samuelswealth.ca
seeleygroup.ca seeleygroup.ca
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
spenceandassociatespwm.com spenceandassociatespwm.com
stephenjudd.us1.advisor.ws stephenjudd.us1.advisor.ws
beginbattinggroup.ca beginbattinggroup.ca
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
vinerandselig.ca vinerandselig.ca
walshmckenziedegroot.com walshmckenziedegroot.com
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
fr.gallantgrouppwm.com fr.gallantgrouppwm.com
clairehallam.us1.advisor.ws clairehallam.us1.advisor.ws
claudegallantandassociates.com claudegallantandassociates.com
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
desrochersassociates.us1.advisor.ws desrochersassociates.us1.advisor.ws
equipelangevin.ca equipelangevin.ca
equipeyl.ca equipeyl.ca
igfr.us1.advisor.ws igfr.us1.advisor.ws
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
equipetgt.ca equipetgt.ca
greengrouppwm.com greengrouppwm.com
huebertandassociates.com huebertandassociates.com
clayfung.ca clayfung.ca
hopkinspopeandassociates.ca hopkinspopeandassociates.ca
fayeafshar.com fayeafshar.com
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
lylekarasick.com lylekarasick.com
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
rawlukprivatewealth.com rawlukprivatewealth.com
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
rspence.us1.advisor.ws rspence.us1.advisor.ws
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
scottsyrja.com scottsyrja.com
alonsoyuffeandassociates.ca alonsoyuffeandassociates.ca
spencelockiegroup.ca spencelockiegroup.ca
taylorzapotoczny.com taylorzapotoczny.com
themorristeam.ca themorristeam.ca
wiartpearsonakle.com wiartpearsonakle.com
davidhames.ca davidhames.ca
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
dhames.us1.advisor.ws dhames.us1.advisor.ws
duanerunzer.us1.advisor.ws duanerunzer.us1.advisor.ws
equipeannegrypinich.ca equipeannegrypinich.ca
equipegilbertpereira.com equipegilbertpereira.com
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
esserprivatewealth.com esserprivatewealth.com
foxrevettassociates.com foxrevettassociates.com
gobelandassociates.com gobelandassociates.com
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
hopebirkettdawson.ca hopebirkettdawson.ca
kboudreauandassociates.ca kboudreauandassociates.ca
johncornwallandassociates.com johncornwallandassociates.com
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
karlchoquettegestionprivee.ca karlchoquettegestionprivee.ca
larmandgroup.com larmandgroup.com
mabeeandassociatespwm.com mabeeandassociatespwm.com
mastroianniassociatespwm.us1.advisor.ws mastroianniassociatespwm.us1.advisor.ws
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
naultgrouppwm.ca naultgrouppwm.ca
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
osmondfindlay.us1.advisor.ws osmondfindlay.us1.advisor.ws
berardinelligroup.com berardinelligroup.com
amandagraham-rowe.com amandagraham-rowe.com
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
bouwmeestergroup.ca bouwmeestergroup.ca
dumitruflanaganandassociates.com dumitruflanaganandassociates.com
gallantgrouppwm.com gallantgrouppwm.com
lacassedelariera.com lacassedelariera.com
dennishuntandassociates.ca dennishuntandassociates.ca
dewashrafandassociates.ca dewashrafandassociates.ca
robdaumler.com robdaumler.com
saccoandassociates.ca saccoandassociates.ca
sandraramosandassociates.ca sandraramosandassociates.ca
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
sidarosetassocies.ca sidarosetassocies.ca
sifnakisgroup.com sifnakisgroup.com
slaunwhiteassociates.us1.advisor.ws slaunwhiteassociates.us1.advisor.ws
anholtgrouppwm.us1.advisor.ws anholtgrouppwm.us1.advisor.ws
angelomanzo.com angelomanzo.com
backup002.us1.advisor.ws backup002.us1.advisor.ws
thomassavage.ca thomassavage.ca
vanderschuitlamb.ca vanderschuitlamb.ca
wanandassociates.com wanandassociates.com
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
wheelermcivor.ca wheelermcivor.ca
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
fr.paulvaillancourt.com fr.paulvaillancourt.com
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
csmprivatewealth.ca csmprivatewealth.ca
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
engeviksaleskigroup.com engeviksaleskigroup.com
equipebenoitlauzon.ca equipebenoitlauzon.ca
equipefrancismarleau.ca equipefrancismarleau.ca
evanriddell.com evanriddell.com
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
gaylortachauer.ca gaylortachauer.ca
hagueandassociates.ca hagueandassociates.ca
halsimonson.ca halsimonson.ca
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
igtestsite.us1.advisor.ws igtestsite.us1.advisor.ws
jasonblucke.us1.advisor.ws jasonblucke.us1.advisor.ws
kennedyassociates.ca kennedyassociates.ca
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
lalliandassociates.com lalliandassociates.com
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
nasonandrose.ca nasonandrose.ca
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
osmondfindlay.ca osmondfindlay.ca
paulvaillancourt.com paulvaillancourt.com
rapwm.com rapwm.com
hendriksprivatewealth.ca hendriksprivatewealth.ca
jesseharris.ca jesseharris.ca
mcclureandcassar.ca mcclureandcassar.ca
daviesmahnke.com daviesmahnke.com
budhuandassociates.ca budhuandassociates.ca
giannonejoncasetassocies.ca giannonejoncasetassocies.ca
donnellygrouppwm.com donnellygrouppwm.com
dawsonandassociatespwm.com dawsonandassociatespwm.com
groupeberardinelli.com groupeberardinelli.com
groupemanzo.com groupemanzo.com
dionetassocies.ca dionetassocies.ca
MEHROTRAGROUP.COM
IP History

Click the IP addresses to see over domains using them.