DAVIDHAMES.CA
Shared Attributes
Domain
agrawalassociates.ca agrawalassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Jan 2025 2 years, 49 days
GTM GTM-G-0FSFL4QW1Q Aug 2022 Aug 2022 One Off
courcellesgroup.com courcellesgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
GTM GTM-G-0FSFL4QW1Q Aug 2022 Aug 2022 One Off
dallaireandassociates.ca dallaireandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
GTM GTM-G-0FSFL4QW1Q Aug 2022 Aug 2022 One Off
kudrowichpwm.com kudrowichpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2024 2 years, 204 days
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 235 days
larouchepwm.ca larouchepwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Jan 2025 138 days
lovisandassociates.com lovisandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Sep 2022 137 days
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2024 2 years, 6 days
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 232 days
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 324 days
mertenswealth.com mertenswealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 231 days
nathalygagnon.com nathalygagnon.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 136 days
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 May 2024 226 days
paziukandassociates.com paziukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2024 1 year, 360 days
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 291 days
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 291 days
rickdellpwm.com rickdellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 127 days
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Sep 2024 1 year, 334 days
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Aug 2024 2 years, 64 days
sajoetassocies.ca sajoetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Oct 2024 13 days
salsbury.ca salsbury.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2024 Oct 2024 238 days
scepanovicandassociates.com scepanovicandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 125 days
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Sep 2024 2 years, 108 days
seeleyandshoemaker.com seeleyandshoemaker.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 138 days
sharifosterandassociates.ca sharifosterandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Oct 2024 119 days
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2023 101 days
simundsonandassociates.ca simundsonandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 163 days
slaunwhiteandassociates.ca slaunwhiteandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Oct 2024 99 days
stephenstruthers.us1.advisor.ws stephenstruthers.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Aug 2024 97 days
stevensandassociates.ca stevensandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 351 days
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 63 days
sylvielefebvre.com sylvielefebvre.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
thekilgourgroup.com thekilgourgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
baileyassociates.ca baileyassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jan 2025 229 days
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 179 days
tobacpwm.com tobacpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
bcbgestionprivee.com bcbgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Nov 2024 1 year, 118 days
beaulieulebuis.com beaulieulebuis.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 269 days
trudybuttandassociates.com trudybuttandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
benkeandassociates.com benkeandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Apr 2024 2 years, 1 day
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2024 1 year, 331 days
vignoneassociatespwm.com vignoneassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 114 days
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 45 days
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 88 days
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 187 days
brunotherrien.us1.advisor.ws brunotherrien.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Nov 2022 One Off
wolkerandassociatespwm.com wolkerandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
cameronrennieandassociates.com cameronrennieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jan 2025 1 year, 172 days
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Aug 2024 1 year, 292 days
zarnlochheadpwm.com zarnlochheadpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2024 1 year, 155 days
chiodobirkettandassociates.com chiodobirkettandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2023 336 days
claudegallant.com claudegallant.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 89 days
claudegallantigprivatewealthcom.us1.advisor.ws claudegallantigprivatewealthcom.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Dec 2022 One Off
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Aug 2024 1 year, 26 days
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
dargisgroup.ca dargisgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 180 days
davedesrochers.ca davedesrochers.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jan 2025 1 year, 225 days
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 56 days
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 128 days
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 125 days
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
equipedaoust.ca equipedaoust.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jan 2025 1 year, 287 days
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
equipemicheldesbiens.com equipemicheldesbiens.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 265 days
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2022 241 days
finchgoodale.com finchgoodale.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jan 2025 1 year, 220 days
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2023 343 days
floermillikengroup.com floermillikengroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 117 days
fredpentz.us1.advisor.ws fredpentz.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jan 2025 241 days
freemangroup.us1.advisor.ws freemangroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
gagrawal.us1.advisor.ws gagrawal.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jul 2024 93 days
garofaloandassociates.ca garofaloandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 83 days
garofalodonato.ca garofalodonato.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Jan 2025 140 days
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 82 days
hopeandassociates.ca hopeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2022 147 days
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 255 days
jeffsomerspwm.com jeffsomerspwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Aug 2023 1 year, 81 days
jenningsandassociates.ca jenningsandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Apr 2023 327 days
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2022 229 days
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jul 2024 1 year, 293 days
jonathandaviespwm.ca jonathandaviespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 251 days
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 69 days
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Dec 2023 201 days
kennedyassociateswm.us1.advisor.ws kennedyassociateswm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 112 days
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Jan 2025 2 years, 42 days
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2025 2 years, 94 days
anjalijensen.com anjalijensen.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 276 days
markewert.com markewert.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jan 2025 1 year, 268 days
equipesoniagosselin.ca equipesoniagosselin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Jan 2025 74 days
bourgeaultandassociates.com bourgeaultandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
bowtellandassociate.ca bowtellandassociate.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Jan 2025 76 days
metzgergroup.ca metzgergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Jan 2025 1 year, 149 days
mehrotragroup.com mehrotragroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 1 year, 361 days
loretoryder.com loretoryder.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 234 days
daumlermertzwealth.ca daumlermertzwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2024 Jan 2025 42 days
buhrblaylock.com buhrblaylock.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
canningandpoolegroup.ca canningandpoolegroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 182 days
mielefinancialgroup.ca mielefinancialgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 230 days
chmprivatewealth.ca chmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Jan 2025 2 years, 131 days
chsmwealth.ca chsmwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jan 2025 219 days
mauriziomastroianni.com mauriziomastroianni.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jan 2025 238 days
freemangroup.ca freemangroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 262 days
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 237 days
farrowandassociatespwm.com farrowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 264 days
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 260 days
kalinkaprivatewealth.com kalinkaprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Jan 2025 1 year, 212 days
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jul 2024 1 year, 107 days
karasickprivatewealth.com karasickprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jun 2023 256 days
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jul 2024 1 year, 301 days
kcmprivatewealth.ca kcmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Jan 2025 1 year, 154 days
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2023 178 days
kevinkaiser.ca kevinkaiser.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2024 2 years, 202 days
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 60 days
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 79 days
leavittgroup.ca leavittgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 235 days
lehouxgestionprivee.com lehouxgestionprivee.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 235 days
lerouxpepin.ca lerouxpepin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Jan 2025 106 days
lisabell.ca lisabell.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Apr 2023 329 days
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Apr 2023 193 days
loboandassociatespwm.ca loboandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jan 2025 2 years
macmahonandassociates.com macmahonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jun 2023 254 days
markewert.us1.advisor.ws markewert.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 39 days
mignaultprivatewealth.com mignaultprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 19 days
millarddawes.com millarddawes.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2024 1 year, 239 days
mondouetassocies.com mondouetassocies.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 321 days
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 320 days
nolintoogood.ca nolintoogood.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2024 1 year, 55 days
nturner.us1.advisor.ws nturner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Sep 2024 2 years, 121 days
paughcarlsonwealth.ca paughcarlsonwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Sep 2024 88 days
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 May 2024 1 year, 225 days
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 May 2024 1 year, 225 days
peterdefrancesco.com peterdefrancesco.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 131 days
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jun 2024 1 year, 139 days
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 100 days
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jun 2024 1 year, 240 days
potvinlemayetassocies.ca potvinlemayetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Oct 2024 13 days
powellpwm.com powellpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 130 days
princeandassociates.ca princeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 256 days
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Aug 2024 2 years, 64 days
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Sep 2024 2 years, 106 days
ryangroupwealth.com ryangroupwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2024 1 year, 353 days
samuelswealth.ca samuelswealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Oct 2024 13 days
schillerspence.ca schillerspence.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Oct 2024 1 year, 250 days
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Feb 2024 1 year, 310 days
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 193 days
seeleygroup.ca seeleygroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 353 days
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Nov 2023 121 days
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 37 days
snowandassociatespwm.com snowandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 122 days
spenceandassociatespwm.com spenceandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 23 days
stephenjudd.us1.advisor.ws stephenjudd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Sep 2024 148 days
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2024 2 years, 171 days
stevenboydpwm.com stevenboydpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
taylorzapotoczny.us1.advisor.ws taylorzapotoczny.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Jun 2022 One Off
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 140 days
beginbattinggroup.ca beginbattinggroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jan 2025 243 days
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2024 1 year, 334 days
vickendurgerian.com vickendurgerian.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Oct 2024 1 year, 158 days
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Mar 2024 194 days
vinerandselig.ca vinerandselig.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Oct 2024 100 days
walshmckenziedegroot.com walshmckenziedegroot.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2024 1 year, 43 days
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Feb 2023 Jul 2024 1 year, 135 days
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 46 days
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 May 2024 1 year, 180 days
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2024 1 year, 340 days
brodieandassociates.com brodieandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 187 days
carneylyster.com carneylyster.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
gallantgrouppwm.com fr.gallantgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Nov 2024 50 days
clairehallam.us1.advisor.ws clairehallam.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 110 days
claudegallantandassociates.com claudegallantandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 89 days
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 127 days
colbournegroup.com colbournegroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jan 2025 1 year, 297 days
coleentaylor.ca coleentaylor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Jan 2025 2 years, 129 days
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Nov 2023 1 year, 226 days
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 128 days
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 128 days
desrochersassociates.us1.advisor.ws desrochersassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jun 2024 40 days
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 88 days
donfox.net donfox.net
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 268 days
elliottchaulk.com elliottchaulk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 266 days
equipelangevin.ca equipelangevin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2024 Jan 2025 27 days
equipetremblay.com equipetremblay.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 265 days
equipeyl.ca equipeyl.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 252 days
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 May 2024 1 year, 54 days
gibbingsandassociates.com gibbingsandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 260 days
ginettebradette.ca ginettebradette.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 233 days
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 79 days
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2024 2 years, 9 days
jasondaleo.ca jasondaleo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2023 260 days
jennerandassociates.com jennerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 237 days
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 May 2024 1 year, 243 days
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2024 2 years, 10 days
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
gabechiodo.ca gabechiodo.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jan 2025 1 year, 228 days
mcgrathandassociateswm.com mcgrathandassociateswm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 192 days
equipetgt.ca equipetgt.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Jan 2025 95 days
greengrouppwm.com greengrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jan 2025 1 year, 281 days
harveypwm.ca harveypwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 111 days
johnmazziotti.com johnmazziotti.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 237 days
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 260 days
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 104 days
carterprivatewealth.com carterprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
milngroup.com milngroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 230 days
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 236 days
charbonneauetassocies.ca charbonneauetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Jan 2025 2 years, 131 days
clayfung.ca clayfung.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Jan 2025 1 year, 47 days
anholtgroup.ca anholtgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Jan 2025 1 year, 56 days
mariodufouretassociees.ca mariodufouretassociees.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 193 days
hopkinspopeandassociates.ca hopkinspopeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 183 days
jenningsgroup.ca jenningsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 237 days
dehartandassociates.com dehartandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
michelleboeuf.us1.advisor.ws michelleboeuf.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 249 days
landriaultpwm.com landriaultpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jan 2025 1 year, 271 days
edbootle.ca edbootle.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 267 days
fayeafshar.com fayeafshar.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 264 days
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 258 days
huebertandassociates.com huebertandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 251 days
irenevassalo.com irenevassalo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 254 days
juddbissonandassociates.com juddbissonandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 237 days
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2023 1 year
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Sep 2024 1 year, 334 days
rawlukprivatewealth.com rawlukprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 127 days
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 291 days
roesthovesquire.ca roesthovesquire.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 162 days
rspence.us1.advisor.ws rspence.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2024 1 year, 353 days
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Sep 2024 2 years, 108 days
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Aug 2024 2 years, 81 days
scottsyrja.com scottsyrja.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jun 2024 1 year, 232 days
alonsoyuffeandassociates.ca alonsoyuffeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Jan 2025 146 days
spencelockiegroup.ca spencelockiegroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Oct 2024 147 days
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jun 2024 1 year, 228 days
sylvainmorin.ca sylvainmorin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 63 days
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 May 2023 185 days
taylorzapotoczny.com taylorzapotoczny.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
themorristeam.ca themorristeam.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 178 days
thiessenpwm.com thiessenpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Jul 2024 1 year, 224 days
tmassociates.ca tmassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 181 days
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Mar 2024 1 year, 335 days
wannerandassociates.ca wannerandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 186 days
wherryandassociates.ca wherryandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 187 days
wiartpearsonakle.com wiartpearsonakle.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Oct 2024 162 days
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 119 days
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 85 days
woodwardandassociates.ca woodwardandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Aug 2024 2 years, 126 days
costantinigroup.ca costantinigroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Jun 2024 1 year, 182 days
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 56 days
ddkpwm.ca ddkpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 126 days
dhames.us1.advisor.ws dhames.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 89 days
donfox.us1.advisor.ws donfox.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 58 days
duanerunzer.us1.advisor.ws duanerunzer.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 110 days
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 87 days
equipeannegrypinich.ca equipeannegrypinich.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2025 Jan 2025 One Off
equipegilbertpereira.com equipegilbertpereira.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 120 days
equipemarcantoinereid.com equipemarcantoinereid.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 265 days
equipesimonaube.com equipesimonaube.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 265 days
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 59 days
equipeyanickjuneau.ca equipeyanickjuneau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 265 days
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 86 days
esserprivatewealth.com esserprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 265 days
flanaganandassociates.ca flanaganandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 232 days
floerfarrowpwm.com floerfarrowpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2023 1 year, 158 days
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
foxrevettassociates.com foxrevettassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 262 days
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2022 242 days
gerberteam.com gerberteam.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 261 days
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
girardandassociates.com girardandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 114 days
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Dec 2023 1 year, 235 days
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 71 days
hopebirkettdawson.ca hopebirkettdawson.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 158 days
kboudreauandassociates.ca kboudreauandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 157 days
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2024 2 years, 9 days
jeffsmithpwm.ca jeffsmithpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 105 days
johncornwallandassociates.com johncornwallandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 237 days
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Dec 2022 229 days
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 237 days
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 60 days
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 69 days
karlchoquettegestionprivee.ca karlchoquettegestionprivee.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 213 days
kenwardgrouppwm.com kenwardgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Dec 2024 1 year, 239 days
kjonesandassociates.ca kjonesandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 May 2022 One Off
kucherawyandassociates.ca kucherawyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 236 days
lacassedelarierafr.us1.advisor.ws lacassedelarierafr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2023 97 days
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 59 days
larmandgroup.com larmandgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 235 days
lylekarasick.com lylekarasick.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2023 99 days
mabeeandassociatespwm.com mabeeandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2024 1 year, 230 days
marcovendramini.com marcovendramini.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2024 Dec 2024 One Off
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 99 days
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jun 2024 1 year, 267 days
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jun 2024 1 year, 75 days
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 39 days
mastroianniassociatespwm.us1.advisor.ws mastroianniassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Aug 2024 114 days
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 May 2024 288 days
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 318 days
millardwealth.com millardwealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 249 days
naultgrouppwm.ca naultgrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 136 days
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Aug 2024 2 years, 97 days
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2024 1 year, 244 days
osmondfindlay.us1.advisor.ws osmondfindlay.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2024 May 2024 118 days
pentzwebsterandassociates.com pentzwebsterandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 170 days
philippedumont.com philippedumont.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 131 days
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 12 days
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Sep 2024 1 year, 142 days
pompu.ca pompu.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 220 days
bayandassociates.ca bayandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Jan 2025 2 years, 42 days
berardinelligroup.com berardinelligroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 268 days
amandagraham-rowe.com amandagraham-rowe.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jan 2025 232 days
blackbelyea.com blackbelyea.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2022 Jan 2025 2 years, 173 days
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
mignaultbadder.ca mignaultbadder.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Jan 2025 155 days
godwinandassociates.ca godwinandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 260 days
bouwmeestergroup.ca bouwmeestergroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 265 days
syrja.ca syrja.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
dumitruflanaganandassociates.com dumitruflanaganandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 252 days
brentmacdonald.ca brentmacdonald.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
gallantgrouppwm.com gallantgrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Jan 2025 140 days
markwebster.ca markwebster.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 250 days
hoffmangrouppwm.ca hoffmangrouppwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 257 days
dupuispwm.com dupuispwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Jan 2025 2 years, 27 days
equipealainbrunet.com equipealainbrunet.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 265 days
lacassedelariera.com lacassedelariera.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 235 days
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 237 days
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 97 days
danylukandassociates.com danylukandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2022 Jan 2025 2 years, 127 days
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 115 days
karenandkayla.ca karenandkayla.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 236 days
jasonblucke.com jasonblucke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 105 days
dennishuntandassociates.ca dennishuntandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
dewashrafandassociates.ca dewashrafandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 216 days
gobelandassociates.com gobelandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 260 days
reishelpwm.com reishelpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 127 days
richardwutzke.com richardwutzke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 127 days
robdaumler.com robdaumler.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2024 2 years, 127 days
robeby.com robeby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Jan 2025 2 years, 216 days
runzerandassociates.com runzerandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2024 1 year, 107 days
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Sep 2024 1 year, 334 days
saccoandassociates.ca saccoandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Oct 2024 44 days
sandraramosandassociates.ca sandraramosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 353 days
santosandassociates.ca santosandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Oct 2024 1 year, 165 days
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2024 1 year, 115 days
sharmaandassociatespwm.com sharmaandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 181 days
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 352 days
sidarosetassocies.ca sidarosetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Oct 2024 134 days
sifnakisgroup.com sifnakisgroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Oct 2024 1 year, 105 days
slaunwhiteassociates.us1.advisor.ws slaunwhiteassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Sep 2024 145 days
anna-marierasmussen.ca anna-marierasmussen.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Sep 2023 1 year, 151 days
anholtgrouppwm.us1.advisor.ws anholtgrouppwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Aug 2024 98 days
angelomanzo.com angelomanzo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 276 days
squireassociates.ca squireassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Feb 2023 102 days
stranskyandassociates.ca stranskyandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Oct 2024 1 year, 347 days
backup002.us1.advisor.ws backup002.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2024 Jun 2024 30 days
thlprivatewealth.com thlprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Oct 2024 1 year, 342 days
thomassavage.ca thomassavage.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 182 days
toddandassociatespwm.com toddandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2024 2 years, 183 days
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 64 days
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Oct 2023 1 year, 201 days
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Feb 2023 102 days
vanderschuitlamb.ca vanderschuitlamb.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Oct 2024 99 days
wanandassociates.com wanandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2023 Oct 2024 346 days
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Mar 2024 253 days
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 45 days
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Mar 2023 Jul 2024 1 year, 120 days
wheelermcivor.ca wheelermcivor.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2023 Oct 2024 1 year, 44 days
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2022 Nov 2024 2 years, 109 days
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Aug 2024 1 year, 28 days
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2023 Jul 2023 One Off
csmprivatewealth.ca csmprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 181 days
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2023 Aug 2024 332 days
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jul 2024 2 years, 88 days
elevateyourwealth.ca elevateyourwealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2023 Jan 2025 1 year, 222 days
engeviksaleskigroup.com engeviksaleskigroup.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jul 2024 Jan 2025 179 days
equipebenoitlauzon.ca equipebenoitlauzon.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 215 days
equipefrancismarleau.ca equipefrancismarleau.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 215 days
evanriddell.com evanriddell.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2023 Aug 2024 259 days
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jun 2024 2 years, 61 days
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 May 2024 2 years, 33 days
gaylortachauer.ca gaylortachauer.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 261 days
greghillaby.com greghillaby.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2023 Jan 2025 1 year, 217 days
hallamandassociates.com hallamandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Jan 2025 2 years, 15 days
halsimonson.ca halsimonson.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 251 days
hansonprivatewealth.ca hansonprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 258 days
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Dec 2022 96 days
jasonblucke.us1.advisor.ws jasonblucke.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Jan 2025 107 days
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 May 2024 1 year, 243 days
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 68 days
kathyduguaypwm.com kathyduguaypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jan 2025 1 year, 273 days
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jul 2024 2 years, 74 days
lalliandassociates.com lalliandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2023 1 year, 141 days
leboeufpwm.com leboeufpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 100 days
macdougallandmaticpwm.com macdougallandmaticpwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jan 2023 Jul 2024 1 year, 188 days
marianasemenchuk.com marianasemenchuk.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 232 days
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 39 days
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2024 2 years, 40 days
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 231 days
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Aug 2024 1 year, 303 days
nasonandrose.ca nasonandrose.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Aug 2024 Oct 2024 39 days
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2022 Jan 2023 99 days
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Aug 2024 2 years, 92 days
nolinandassociatespwm.com nolinandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jun 2023 1 year, 23 days
osmondfindlay.ca osmondfindlay.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2023 Oct 2024 358 days
paulvaillancourt.com paulvaillancourt.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Oct 2024 2 years, 132 days
rapwm.com rapwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Oct 2023 1 year, 138 days
methorstandassociates.ca methorstandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 231 days
hendriksprivatewealth.ca hendriksprivatewealth.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Oct 2024 Jan 2025 73 days
kapwm.ca kapwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Jan 2025 2 years, 7 days
jesseharris.ca jesseharris.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2023 Jan 2025 1 year, 14 days
robeby.us1.advisor.ws robeby.us1.advisor.ws
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2022 Jan 2025 2 years, 216 days
mcclureandcassar.ca mcclureandcassar.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 192 days
daviesmahnke.com daviesmahnke.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
equipestephanethibeault.ca equipestephanethibeault.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2024 Jan 2025 22 days
equipelaforme.com equipelaforme.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 265 days
jwrossandassociates.ca jwrossandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 104 days
brunotherrien.ca brunotherrien.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
budhuandassociates.ca budhuandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 263 days
giannonejoncasetassocies.ca giannonejoncasetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 195 days
elaineandrewandassociates.com elaineandrewandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 266 days
donnellygrouppwm.com donnellygrouppwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 268 days
dalesmallgroup.ca dalesmallgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Jan 2025 2 years, 31 days
loweandassociates.ca loweandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 234 days
mcinroypwm.com mcinroypwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2023 Jan 2025 1 year, 267 days
geeandassociates.ca geeandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 261 days
dawsonandassociatespwm.com dawsonandassociatespwm.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 270 days
groupeberardinelli.com groupeberardinelli.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 251 days
equipejeanthomasmenard.com equipejeanthomasmenard.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 120 days
mhmrpwm.ca mhmrpwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 230 days
equipelptoupin.ca equipelptoupin.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 120 days
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025 2 years, 268 days
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD May 2022 Jan 2025 2 years, 233 days
groupemanzo.com groupemanzo.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Apr 2024 Jan 2025 251 days
lyleandassociatespwm.ca lyleandassociatespwm.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 193 days
bastgroup.ca bastgroup.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Nov 2022 Jan 2025 2 years, 42 days
deprezandassociates.com deprezandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Dec 2022 Jan 2025 2 years, 30 days
desfossesgoulet.ca desfossesgoulet.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2022 Jan 2025 2 years, 126 days
dionetassocies.ca dionetassocies.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Jun 2024 Jan 2025 216 days
hagueandassociates.ca hagueandassociates.ca
Attribute Value First Detected Last Detected Overlap Duration
SC SC-INVESTORSGRIG.COMPROD Sep 2024 Jan 2025 108 days
DAVIDHAMES.CA
Non IP Attributes
Attribute First Last
SC SC-INVESTORSGRIG.COMPROD Apr 2022 Jan 2025
GTM GTM-G-0FSFL4QW1Q Aug 2022 Aug 2022
DAVIDHAMES.CA
Overlap Attribute Domains
agrawalassociates.ca agrawalassociates.ca
courcellesgroup.com courcellesgroup.com
dallaireandassociates.ca dallaireandassociates.ca
davidhames.ca davidhames.ca
kudrowichpwm.com kudrowichpwm.com
laceyprivatewealthmanagement.com laceyprivatewealthmanagement.com
larouchepwm.ca larouchepwm.ca
lovisandassociates.com lovisandassociates.com
marilyngiesbrecht.us1.advisor.ws marilyngiesbrecht.us1.advisor.ws
markdehartassociatespwm.us1.advisor.ws markdehartassociatespwm.us1.advisor.ws
mceachniemathewsgroup.us1.advisor.ws mceachniemathewsgroup.us1.advisor.ws
mertenswealth.com mertenswealth.com
nathalygagnon.com nathalygagnon.com
nolintoogoodpwm.us1.advisor.ws nolintoogoodpwm.us1.advisor.ws
paziukandassociates.com paziukandassociates.com
rettingerandassociatespwm.us1.advisor.ws rettingerandassociatespwm.us1.advisor.ws
richardwutzke.us1.advisor.ws richardwutzke.us1.advisor.ws
rickdellpwm.com rickdellpwm.com
rkoutsogiannopoulos.us1.advisor.ws rkoutsogiannopoulos.us1.advisor.ws
robmiln.us1.advisor.ws robmiln.us1.advisor.ws
sajoetassocies.ca sajoetassocies.ca
salsbury.ca salsbury.ca
scepanovicandassociates.com scepanovicandassociates.com
schillerspence.us1.advisor.ws schillerspence.us1.advisor.ws
seeleyandshoemaker.com seeleyandshoemaker.com
sharifosterandassociates.ca sharifosterandassociates.ca
simonaube.us1.advisor.ws simonaube.us1.advisor.ws
simundsonandassociates.ca simundsonandassociates.ca
slaunwhiteandassociates.ca slaunwhiteandassociates.ca
stephenstruthers.us1.advisor.ws stephenstruthers.us1.advisor.ws
stevensandassociates.ca stevensandassociates.ca
sylvainmorin.us1.advisor.ws sylvainmorin.us1.advisor.ws
sylvielefebvre.com sylvielefebvre.com
thekilgourgroup.com thekilgourgroup.com
baileyassociates.ca baileyassociates.ca
todwoodward.us1.advisor.ws todwoodward.us1.advisor.ws
tobacpwm.com tobacpwm.com
bcbgestionprivee.com bcbgestionprivee.com
beaulieulebuis.com beaulieulebuis.com
trudybuttandassociates.com trudybuttandassociates.com
benkeandassociates.com benkeandassociates.com
tsavageandassociates.us1.advisor.ws tsavageandassociates.us1.advisor.ws
vignoneassociatespwm.com vignoneassociatespwm.com
bourgeaultandassociates.us1.advisor.ws bourgeaultandassociates.us1.advisor.ws
brianblair.us1.advisor.ws brianblair.us1.advisor.ws
whiteheadmackaymcneill.us1.advisor.ws whiteheadmackaymcneill.us1.advisor.ws
brunotherrien.us1.advisor.ws brunotherrien.us1.advisor.ws
wolkerandassociatespwm.com wolkerandassociatespwm.com
cameronrennieandassociates.com cameronrennieandassociates.com
yanickjuneau.us1.advisor.ws yanickjuneau.us1.advisor.ws
zarnlochheadpwm.com zarnlochheadpwm.com
chiodobirkettandassociates.com chiodobirkettandassociates.com
claudegallant.com claudegallant.com
claudegallantigprivatewealthcom.us1.advisor.ws claudegallantigprivatewealthcom.us1.advisor.ws
collinprince.us1.advisor.ws collinprince.us1.advisor.ws
coreykudrowich.us1.advisor.ws coreykudrowich.us1.advisor.ws
dargisgroup.ca dargisgroup.ca
davedesrochers.ca davedesrochers.ca
dawsonandassociates.us1.advisor.ws dawsonandassociates.us1.advisor.ws
dennishuntassociates.us1.advisor.ws dennishuntassociates.us1.advisor.ws
duanegee.us1.advisor.ws duanegee.us1.advisor.ws
equipealainbrunet.us1.advisor.ws equipealainbrunet.us1.advisor.ws
equipedaoust.ca equipedaoust.ca
equipelaforme.us1.advisor.ws equipelaforme.us1.advisor.ws
equipemicheldesbiens.com equipemicheldesbiens.com
equipetremblay.us1.advisor.ws equipetremblay.us1.advisor.ws
finchgoodale.com finchgoodale.com
flanaganassociates.us1.advisor.ws flanaganassociates.us1.advisor.ws
floermillikengroup.com floermillikengroup.com
fredpentz.us1.advisor.ws fredpentz.us1.advisor.ws
freemangroup.us1.advisor.ws freemangroup.us1.advisor.ws
gagrawal.us1.advisor.ws gagrawal.us1.advisor.ws
garofaloandassociates.ca garofaloandassociates.ca
garofalodonato.ca garofalodonato.ca
giesbrechtboudreauandassociates.com giesbrechtboudreauandassociates.com
hopeandassociates.ca hopeandassociates.ca
igprivatewealthmanagement.us1.advisor.ws igprivatewealthmanagement.us1.advisor.ws
jeffsomerspwm.com jeffsomerspwm.com
jenningsandassociates.ca jenningsandassociates.ca
jfgirardfr.us1.advisor.ws jfgirardfr.us1.advisor.ws
johnstransky.us1.advisor.ws johnstransky.us1.advisor.ws
jonathandaviespwm.ca jonathandaviespwm.ca
karenandkayla.us1.advisor.ws karenandkayla.us1.advisor.ws
kdsullivan.us1.advisor.ws kdsullivan.us1.advisor.ws
kennedyassociateswm.us1.advisor.ws kennedyassociateswm.us1.advisor.ws
bayandassociates.us1.advisor.ws bayandassociates.us1.advisor.ws
michaelbuhr.us1.advisor.ws michaelbuhr.us1.advisor.ws
anjalijensen.com anjalijensen.com
markewert.com markewert.com
equipesoniagosselin.ca equipesoniagosselin.ca
bourgeaultandassociates.com bourgeaultandassociates.com
bowtellandassociate.ca bowtellandassociate.ca
metzgergroup.ca metzgergroup.ca
mehrotragroup.com mehrotragroup.com
loretoryder.com loretoryder.com
daumlermertzwealth.ca daumlermertzwealth.ca
buhrblaylock.com buhrblaylock.com
angelareaandassociatesprivatewealth.com angelareaandassociatesprivatewealth.com
canningandpoolegroup.ca canningandpoolegroup.ca
mielefinancialgroup.ca mielefinancialgroup.ca
chmprivatewealth.ca chmprivatewealth.ca
chsmwealth.ca chsmwealth.ca
mauriziomastroianni.com mauriziomastroianni.com
freemangroup.ca freemangroup.ca
jenningsgrouppwm.us1.advisor.ws jenningsgrouppwm.us1.advisor.ws
farrowandassociatespwm.com farrowandassociatespwm.com
gobelandassociates.us1.advisor.ws gobelandassociates.us1.advisor.ws
kalinkaprivatewealth.com kalinkaprivatewealth.com
kapwm.us1.advisor.ws kapwm.us1.advisor.ws
karasickprivatewealth.com karasickprivatewealth.com
kathyduguay.us1.advisor.ws kathyduguay.us1.advisor.ws
kcmprivatewealth.ca kcmprivatewealth.ca
kdsullivanwealthstrategies.com kdsullivanwealthstrategies.com
kevinkaiser.ca kevinkaiser.ca
kevinkaiser.us1.advisor.ws kevinkaiser.us1.advisor.ws
kilgourgroup.us1.advisor.ws kilgourgroup.us1.advisor.ws
leavittgroup.ca leavittgroup.ca
lehouxgestionprivee.com lehouxgestionprivee.com
lerouxpepin.ca lerouxpepin.ca
lisabell.ca lisabell.ca
lisabell.us1.advisor.ws lisabell.us1.advisor.ws
loboandassociatespwm.ca loboandassociatespwm.ca
macmahonandassociates.com macmahonandassociates.com
markewert.us1.advisor.ws markewert.us1.advisor.ws
mignaultprivatewealth.com mignaultprivatewealth.com
millarddawes.com millarddawes.com
mondouetassocies.com mondouetassocies.com
neilgaylor.us1.advisor.ws neilgaylor.us1.advisor.ws
nolintoogood.ca nolintoogood.ca
nturner.us1.advisor.ws nturner.us1.advisor.ws
paughcarlsonwealth.ca paughcarlsonwealth.ca
paullarmand.us1.advisor.ws paullarmand.us1.advisor.ws
paulreishel.us1.advisor.ws paulreishel.us1.advisor.ws
peterdefrancesco.com peterdefrancesco.com
petermacmahon.us1.advisor.ws petermacmahon.us1.advisor.ws
philippedumont.us1.advisor.ws philippedumont.us1.advisor.ws
philippoitras.us1.advisor.ws philippoitras.us1.advisor.ws
potvinlemayetassocies.ca potvinlemayetassocies.ca
powellpwm.com powellpwm.com
princeandassociates.ca princeandassociates.ca
rickfloergroup.us1.advisor.ws rickfloergroup.us1.advisor.ws
ricklowe.us1.advisor.ws ricklowe.us1.advisor.ws
ryangroupwealth.com ryangroupwealth.com
samuelswealth.ca samuelswealth.ca
schillerspence.ca schillerspence.ca
seanryder.us1.advisor.ws seanryder.us1.advisor.ws
seeleyandshoemaker.us1.advisor.ws seeleyandshoemaker.us1.advisor.ws
seeleygroup.ca seeleygroup.ca
amritlalli.us1.advisor.ws amritlalli.us1.advisor.ws
angelareaandassociates.us1.advisor.ws angelareaandassociates.us1.advisor.ws
snowandassociatespwm.com snowandassociatespwm.com
spenceandassociatespwm.com spenceandassociatespwm.com
stephenjudd.us1.advisor.ws stephenjudd.us1.advisor.ws
stevenboyd.us1.advisor.ws stevenboyd.us1.advisor.ws
stevenboydpwm.com stevenboydpwm.com
taylorzapotoczny.us1.advisor.ws taylorzapotoczny.us1.advisor.ws
toddassociates.us1.advisor.ws toddassociates.us1.advisor.ws
beginbattinggroup.ca beginbattinggroup.ca
vaillaincourtandassocies.us1.advisor.ws vaillaincourtandassocies.us1.advisor.ws
vickendurgerian.com vickendurgerian.com
vickendurgerianen.us1.advisor.ws vickendurgerianen.us1.advisor.ws
vinerandselig.ca vinerandselig.ca
walshmckenziedegroot.com walshmckenziedegroot.com
wardmacdougall.us1.advisor.ws wardmacdougall.us1.advisor.ws
brianwalkerandassociatespwm.us1.advisor.ws brianwalkerandassociatespwm.us1.advisor.ws
brianwanner.us1.advisor.ws brianwanner.us1.advisor.ws
wesleavitt.us1.advisor.ws wesleavitt.us1.advisor.ws
brodieandassociates.com brodieandassociates.com
whiteheadmackaymcneillprivatewealth.com whiteheadmackaymcneillprivatewealth.com
carneylyster.com carneylyster.com
fr.gallantgrouppwm.com fr.gallantgrouppwm.com
clairehallam.us1.advisor.ws clairehallam.us1.advisor.ws
claudegallantandassociates.com claudegallantandassociates.com
claudegallantandassociatespwm.us1.advisor.ws claudegallantandassociatespwm.us1.advisor.ws
colbournegroup.com colbournegroup.com
coleentaylor.ca coleentaylor.ca
danieldallaire.us1.advisor.ws danieldallaire.us1.advisor.ws
deanmethorst.us1.advisor.ws deanmethorst.us1.advisor.ws
defrancescopwm.us1.advisor.ws defrancescopwm.us1.advisor.ws
desrochersassociates.us1.advisor.ws desrochersassociates.us1.advisor.ws
donaldcourcelles.us1.advisor.ws donaldcourcelles.us1.advisor.ws
donfox.net donfox.net
elliottchaulk.com elliottchaulk.com
equipelangevin.ca equipelangevin.ca
equipetremblay.com equipetremblay.com
equipeyl.ca equipeyl.ca
gabechiodo.us1.advisor.ws gabechiodo.us1.advisor.ws
gibbingsandassociates.com gibbingsandassociates.com
ginettebradette.ca ginettebradette.ca
ianfarrow.us1.advisor.ws ianfarrow.us1.advisor.ws
jamiepowell.us1.advisor.ws jamiepowell.us1.advisor.ws
jasondaleo.ca jasondaleo.ca
jennerandassociates.com jennerandassociates.com
jmabee2.us1.advisor.ws jmabee2.us1.advisor.ws
johncornwall.us1.advisor.ws johncornwall.us1.advisor.ws
johnvignonefr.us1.advisor.ws johnvignonefr.us1.advisor.ws
gabechiodo.ca gabechiodo.ca
mcgrathandassociateswm.com mcgrathandassociateswm.com
equipetgt.ca equipetgt.ca
greengrouppwm.com greengrouppwm.com
harveypwm.ca harveypwm.ca
johnmazziotti.com johnmazziotti.com
gibbingsandassociates.us1.advisor.ws gibbingsandassociates.us1.advisor.ws
johnvignoneen.us1.advisor.ws johnvignoneen.us1.advisor.ws
carterprivatewealth.com carterprivatewealth.com
milngroup.com milngroup.com
kochmiorprivatewealth.ca kochmiorprivatewealth.ca
charbonneauetassocies.ca charbonneauetassocies.ca
clayfung.ca clayfung.ca
anholtgroup.ca anholtgroup.ca
mariodufouretassociees.ca mariodufouretassociees.ca
hopkinspopeandassociates.ca hopkinspopeandassociates.ca
jenningsgroup.ca jenningsgroup.ca
dehartandassociates.com dehartandassociates.com
michelleboeuf.us1.advisor.ws michelleboeuf.us1.advisor.ws
landriaultpwm.com landriaultpwm.com
edbootle.ca edbootle.ca
fayeafshar.com fayeafshar.com
hansonprivatewealth.us1.advisor.ws hansonprivatewealth.us1.advisor.ws
huebertandassociates.com huebertandassociates.com
irenevassalo.com irenevassalo.com
juddbissonandassociates.com juddbissonandassociates.com
rasmussenassociates.us1.advisor.ws rasmussenassociates.us1.advisor.ws
rawlukandassociates.us1.advisor.ws rawlukandassociates.us1.advisor.ws
rawlukprivatewealth.com rawlukprivatewealth.com
robdaumler.us1.advisor.ws robdaumler.us1.advisor.ws
roesthovesquire.ca roesthovesquire.ca
rspence.us1.advisor.ws rspence.us1.advisor.ws
scepanovicandassociatespwm.us1.advisor.ws scepanovicandassociatespwm.us1.advisor.ws
scottmillard.us1.advisor.ws scottmillard.us1.advisor.ws
scottsyrja.com scottsyrja.com
alonsoyuffeandassociates.ca alonsoyuffeandassociates.ca
spencelockiegroup.ca spencelockiegroup.ca
strussanddennyprivatewealthmanagement.ca strussanddennyprivatewealthmanagement.ca
strussanddennypwm.us1.advisor.ws strussanddennypwm.us1.advisor.ws
sylvainmorin.ca sylvainmorin.ca
sylvielefebvreeng.us1.advisor.ws sylvielefebvreeng.us1.advisor.ws
sylvielefebvrefr.us1.advisor.ws sylvielefebvrefr.us1.advisor.ws
taylorzapotoczny.com taylorzapotoczny.com
themorristeam.ca themorristeam.ca
thiessenandassociatespwm.us1.advisor.ws thiessenandassociatespwm.us1.advisor.ws
thiessenpwm.com thiessenpwm.com
barbarawherry.us1.advisor.ws barbarawherry.us1.advisor.ws
tmassociates.ca tmassociates.ca
trudybutt.us1.advisor.ws trudybutt.us1.advisor.ws
vassaloandassociates.us1.advisor.ws vassaloandassociates.us1.advisor.ws
wannerandassociates.ca wannerandassociates.ca
wherryandassociates.ca wherryandassociates.ca
wiartpearsonakle.com wiartpearsonakle.com
bryangirard.us1.advisor.ws bryangirard.us1.advisor.ws
wolkerpwm.us1.advisor.ws wolkerpwm.us1.advisor.ws
woodwardandassociates.ca woodwardandassociates.ca
carterandassociates.us1.advisor.ws carterandassociates.us1.advisor.ws
costantinigroup.ca costantinigroup.ca
danhoffman.us1.advisor.ws danhoffman.us1.advisor.ws
daviesmahnke.us1.advisor.ws daviesmahnke.us1.advisor.ws
ddkpwm.ca ddkpwm.ca
dhames.us1.advisor.ws dhames.us1.advisor.ws
donfox.us1.advisor.ws donfox.us1.advisor.ws
duanerunzer.us1.advisor.ws duanerunzer.us1.advisor.ws
elliottchaulkpwm.us1.advisor.ws elliottchaulkpwm.us1.advisor.ws
equipeannegrypinich.ca equipeannegrypinich.ca
equipegilbertpereira.com equipegilbertpereira.com
equipemarcantoinereid.com equipemarcantoinereid.com
equipesimonaube.com equipesimonaube.com
equipetremblay1.us1.advisor.ws equipetremblay1.us1.advisor.ws
equipeyanickjuneau.ca equipeyanickjuneau.ca
esserandassociates.us1.advisor.ws esserandassociates.us1.advisor.ws
esserprivatewealth.com esserprivatewealth.com
flanaganandassociates.ca flanaganandassociates.ca
floerfarrowpwm.com floerfarrowpwm.com
floerfarrowpwm.us1.advisor.ws floerfarrowpwm.us1.advisor.ws
foxrevettassociates.com foxrevettassociates.com
fredgodwin.us1.advisor.ws fredgodwin.us1.advisor.ws
gerberteam.com gerberteam.com
ginettebradette.us1.advisor.ws ginettebradette.us1.advisor.ws
girardandassociates.com girardandassociates.com
hendrikshuebertandassociates.com hendrikshuebertandassociates.com
hendrikshuebertandassociates.us1.advisor.ws hendrikshuebertandassociates.us1.advisor.ws
hopebirkettdawson.ca hopebirkettdawson.ca
kboudreauandassociates.ca kboudreauandassociates.ca
jamescarney.us1.advisor.ws jamescarney.us1.advisor.ws
jeffsmithpwm.ca jeffsmithpwm.ca
johncornwallandassociates.com johncornwallandassociates.com
johntranter.us1.advisor.ws johntranter.us1.advisor.ws
julienhebertvendramini1.us1.advisor.ws julienhebertvendramini1.us1.advisor.ws
karenbenke.us1.advisor.ws karenbenke.us1.advisor.ws
karenmorris.us1.advisor.ws karenmorris.us1.advisor.ws
karlchoquettegestionprivee.ca karlchoquettegestionprivee.ca
kenwardgrouppwm.com kenwardgrouppwm.com
kjonesandassociates.ca kjonesandassociates.ca
kucherawyandassociates.ca kucherawyandassociates.ca
lacassedelarierafr.us1.advisor.ws lacassedelarierafr.us1.advisor.ws
landriaultassociates.us1.advisor.ws landriaultassociates.us1.advisor.ws
larmandgroup.com larmandgroup.com
lylekarasick.com lylekarasick.com
mabeeandassociatespwm.com mabeeandassociatespwm.com
marcovendramini.com marcovendramini.com
mareidfr.us1.advisor.ws mareidfr.us1.advisor.ws
marianasemenchuk.us1.advisor.ws marianasemenchuk.us1.advisor.ws
markgerber.us1.advisor.ws markgerber.us1.advisor.ws
markjennings.us1.advisor.ws markjennings.us1.advisor.ws
mastroianniassociatespwm.us1.advisor.ws mastroianniassociatespwm.us1.advisor.ws
metzgergroup.us1.advisor.ws metzgergroup.us1.advisor.ws
mignaultprivatewealth.us1.advisor.ws mignaultprivatewealth.us1.advisor.ws
millardwealth.com millardwealth.com
naultgrouppwm.ca naultgrouppwm.ca
naultgrouppwm.us1.advisor.ws naultgrouppwm.us1.advisor.ws
nolinandassociates.us1.advisor.ws nolinandassociates.us1.advisor.ws
osmondfindlay.us1.advisor.ws osmondfindlay.us1.advisor.ws
pentzwebsterandassociates.com pentzwebsterandassociates.com
philippedumont.com philippedumont.com
philiptonge.us1.advisor.ws philiptonge.us1.advisor.ws
pierremondou.us1.advisor.ws pierremondou.us1.advisor.ws
pompu.ca pompu.ca
bayandassociates.ca bayandassociates.ca
berardinelligroup.com berardinelligroup.com
amandagraham-rowe.com amandagraham-rowe.com
blackbelyea.com blackbelyea.com
blairandassociatesprivatewealthmanagement.com blairandassociatesprivatewealthmanagement.com
mignaultbadder.ca mignaultbadder.ca
godwinandassociates.ca godwinandassociates.ca
bouwmeestergroup.ca bouwmeestergroup.ca
syrja.ca syrja.ca
dumitruflanaganandassociates.com dumitruflanaganandassociates.com
brentmacdonald.ca brentmacdonald.ca
gallantgrouppwm.com gallantgrouppwm.com
markwebster.ca markwebster.ca
hoffmangrouppwm.ca hoffmangrouppwm.ca
dupuispwm.com dupuispwm.com
equipealainbrunet.com equipealainbrunet.com
lacassedelariera.com lacassedelariera.com
jeanfrancoisgirard.ca jeanfrancoisgirard.ca
mackieloweprivatewealthmanagement.us1.advisor.ws mackieloweprivatewealthmanagement.us1.advisor.ws
danylukandassociates.com danylukandassociates.com
garofalopwm.us1.advisor.ws garofalopwm.us1.advisor.ws
karenandkayla.ca karenandkayla.ca
jasonblucke.com jasonblucke.com
dennishuntandassociates.ca dennishuntandassociates.ca
dewashrafandassociates.ca dewashrafandassociates.ca
gobelandassociates.com gobelandassociates.com
reishelpwm.com reishelpwm.com
richardwutzke.com richardwutzke.com
robdaumler.com robdaumler.com
robeby.com robeby.com
runzerandassociates.com runzerandassociates.com
ryansnow.us1.advisor.ws ryansnow.us1.advisor.ws
saccoandassociates.ca saccoandassociates.ca
sandraramosandassociates.ca sandraramosandassociates.ca
santosandassociates.ca santosandassociates.ca
scottsyrja.us1.advisor.ws scottsyrja.us1.advisor.ws
sharmaandassociatespwm.com sharmaandassociatespwm.com
shoemakerplaxtongroup.com shoemakerplaxtongroup.com
sidarosetassocies.ca sidarosetassocies.ca
sifnakisgroup.com sifnakisgroup.com
slaunwhiteassociates.us1.advisor.ws slaunwhiteassociates.us1.advisor.ws
anna-marierasmussen.ca anna-marierasmussen.ca
anholtgrouppwm.us1.advisor.ws anholtgrouppwm.us1.advisor.ws
angelomanzo.com angelomanzo.com
squireassociates.ca squireassociates.ca
stranskyandassociates.ca stranskyandassociates.ca
struthersudeaghaandassociates.com struthersudeaghaandassociates.com
backup002.us1.advisor.ws backup002.us1.advisor.ws
thlprivatewealth.com thlprivatewealth.com
thomassavage.ca thomassavage.ca
toddandassociatespwm.com toddandassociatespwm.com
tonymiele.us1.advisor.ws tonymiele.us1.advisor.ws
tranterandassociatesprivatewealthmanagement.com tranterandassociatesprivatewealthmanagement.com
vaillaincourtandassocies1.us1.advisor.ws vaillaincourtandassocies1.us1.advisor.ws
vanderschuitlamb.ca vanderschuitlamb.ca
wanandassociates.com wanandassociates.com
wanassociates.us1.advisor.ws wanassociates.us1.advisor.ws
bradmcphee.us1.advisor.ws bradmcphee.us1.advisor.ws
brentmacdonald.us1.advisor.ws brentmacdonald.us1.advisor.ws
wheelermcivor.ca wheelermcivor.ca
brodieassociatespwm.us1.advisor.ws brodieassociatespwm.us1.advisor.ws
cameronrennie.us1.advisor.ws cameronrennie.us1.advisor.ws
clayfungandassociatesb41.us1.advisor.ws clayfungandassociatesb41.us1.advisor.ws
csmprivatewealth.ca csmprivatewealth.ca
deprezandassociates.us1.advisor.ws deprezandassociates.us1.advisor.ws
donnellygroup.us1.advisor.ws donnellygroup.us1.advisor.ws
elevateyourwealth.ca elevateyourwealth.ca
engeviksaleskigroup.com engeviksaleskigroup.com
equipebenoitlauzon.ca equipebenoitlauzon.ca
equipefrancismarleau.ca equipefrancismarleau.ca
evanriddell.com evanriddell.com
fayeafsharprivatewealth.us1.advisor.ws fayeafsharprivatewealth.us1.advisor.ws
foxrevett.us1.advisor.ws foxrevett.us1.advisor.ws
gaylortachauer.ca gaylortachauer.ca
greghillaby.com greghillaby.com
hallamandassociates.com hallamandassociates.com
halsimonson.ca halsimonson.ca
hansonprivatewealth.ca hansonprivatewealth.ca
hugolehouxfr.us1.advisor.ws hugolehouxfr.us1.advisor.ws
jasonblucke.us1.advisor.ws jasonblucke.us1.advisor.ws
jatindersharma.us1.advisor.ws jatindersharma.us1.advisor.ws
julienhebertvendramini.us1.advisor.ws julienhebertvendramini.us1.advisor.ws
kathyduguaypwm.com kathyduguaypwm.com
lacassedelarieraen.us1.advisor.ws lacassedelarieraen.us1.advisor.ws
lalliandassociates.com lalliandassociates.com
leboeufpwm.com leboeufpwm.com
macdougallandmaticpwm.com macdougallandmaticpwm.com
marianasemenchuk.com marianasemenchuk.com
maryhope.us1.advisor.ws maryhope.us1.advisor.ws
mattkoch.us1.advisor.ws mattkoch.us1.advisor.ws
mceachniematthewsgroup.ca mceachniematthewsgroup.ca
mikekucherawy.us1.advisor.ws mikekucherawy.us1.advisor.ws
nasonandrose.ca nasonandrose.ca
nathalygagnoninvestorsgroupinc.us1.advisor.ws nathalygagnoninvestorsgroupinc.us1.advisor.ws
nathalygagnonpwm01.us1.advisor.ws nathalygagnonpwm01.us1.advisor.ws
nolinandassociatespwm.com nolinandassociatespwm.com
osmondfindlay.ca osmondfindlay.ca
paulvaillancourt.com paulvaillancourt.com
rapwm.com rapwm.com
methorstandassociates.ca methorstandassociates.ca
hendriksprivatewealth.ca hendriksprivatewealth.ca
kapwm.ca kapwm.ca
jesseharris.ca jesseharris.ca
robeby.us1.advisor.ws robeby.us1.advisor.ws
mcclureandcassar.ca mcclureandcassar.ca
daviesmahnke.com daviesmahnke.com
equipestephanethibeault.ca equipestephanethibeault.ca
equipelaforme.com equipelaforme.com
jwrossandassociates.ca jwrossandassociates.ca
brunotherrien.ca brunotherrien.ca
budhuandassociates.ca budhuandassociates.ca
giannonejoncasetassocies.ca giannonejoncasetassocies.ca
elaineandrewandassociates.com elaineandrewandassociates.com
donnellygrouppwm.com donnellygrouppwm.com
dalesmallgroup.ca dalesmallgroup.ca
loweandassociates.ca loweandassociates.ca
mcinroypwm.com mcinroypwm.com
geeandassociates.ca geeandassociates.ca
dawsonandassociatespwm.com dawsonandassociatespwm.com
groupeberardinelli.com groupeberardinelli.com
equipejeanthomasmenard.com equipejeanthomasmenard.com
mhmrpwm.ca mhmrpwm.ca
equipelptoupin.ca equipelptoupin.ca
doyleandassociatesprivatewealth.com doyleandassociatesprivatewealth.com
mackieloweprivatewealthmanagement.ca mackieloweprivatewealthmanagement.ca
groupemanzo.com groupemanzo.com
lyleandassociatespwm.ca lyleandassociatespwm.ca
bastgroup.ca bastgroup.ca
deprezandassociates.com deprezandassociates.com
desfossesgoulet.ca desfossesgoulet.ca
dionetassocies.ca dionetassocies.ca
hagueandassociates.ca hagueandassociates.ca
DAVIDHAMES.CA
IP History

Click the IP addresses to see over domains using them.